SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0024
         (892 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF506023-1|AAM46899.1|   76|Tribolium castaneum polyubiquitin pr...   112   4e-27
AF506022-1|AAM46898.1|  685|Tribolium castaneum polyubiquitin pr...   112   4e-27
AF506021-1|AAM46897.1|   64|Tribolium castaneum polyubiquitin pr...   100   1e-23
AF506020-1|AAM46896.1|  112|Tribolium castaneum polyubiquitin pr...    98   7e-23
AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory recept...    24   1.8  
EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic acetyl...    23   4.3  
EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic acetyl...    23   4.3  
EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic acetyl...    23   4.3  
EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic acetyl...    23   4.3  
EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic acetyl...    23   4.3  
AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain tran...    23   4.3  
EF592538-1|ABQ95984.1|  582|Tribolium castaneum beta-N-acetylglu...    22   7.4  
EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine vasopre...    21   9.8  
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    21   9.8  

>AF506023-1|AAM46899.1|   76|Tribolium castaneum polyubiquitin
           protein.
          Length = 76

 Score =  112 bits (269), Expect = 4e-27
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70


>AF506022-1|AAM46898.1|  685|Tribolium castaneum polyubiquitin
           protein.
          Length = 685

 Score =  112 bits (269), Expect = 4e-27
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 70



 Score =  112 bits (269), Expect = 4e-27
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 93  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 146



 Score =  112 bits (269), Expect = 4e-27
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 169 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 222



 Score =  112 bits (269), Expect = 4e-27
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 245 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 298



 Score =  112 bits (269), Expect = 4e-27
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 321 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 374



 Score =  112 bits (269), Expect = 4e-27
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 473 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 526



 Score =  112 bits (269), Expect = 4e-27
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 549 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 602



 Score =  112 bits (269), Expect = 4e-27
 Identities = 53/54 (98%), Positives = 54/54 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 625 VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 678



 Score =  109 bits (263), Expect = 2e-26
 Identities = 52/54 (96%), Positives = 53/54 (98%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           VEPSDTIENVKAKIQDKEGIPP+QQR IFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 397 VEPSDTIENVKAKIQDKEGIPPDQQRSIFAGKQLEDGRTLSDYNIQKESTLHLV 450


>AF506021-1|AAM46897.1|   64|Tribolium castaneum polyubiquitin
           protein.
          Length = 64

 Score =  100 bits (240), Expect = 1e-23
 Identities = 47/48 (97%), Positives = 48/48 (100%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           VEPSDTIENVKAKIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKE
Sbjct: 17  VEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKE 64


>AF506020-1|AAM46896.1|  112|Tribolium castaneum polyubiquitin
           protein.
          Length = 112

 Score = 98.3 bits (234), Expect = 7e-23
 Identities = 46/48 (95%), Positives = 47/48 (97%)
 Frame = -2

Query: 891 VEPSDTIENVKAKIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKE 748
           VEPSDTIENVKAKIQDKEGIPP+QQR IFAGKQLEDGRTLSDYNIQKE
Sbjct: 65  VEPSDTIENVKAKIQDKEGIPPDQQRSIFAGKQLEDGRTLSDYNIQKE 112



 Score = 88.6 bits (210), Expect = 6e-20
 Identities = 41/42 (97%), Positives = 42/42 (100%)
 Frame = -2

Query: 855 KIQDKEGIPPNQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 730
           KIQDKEGIPP+QQRLIFAGKQLEDGRTLSDYNIQKESTLHLV
Sbjct: 1   KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV 42


>AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory receptor
           candidate 23 protein.
          Length = 291

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 13/36 (36%), Positives = 18/36 (50%)
 Frame = +2

Query: 566 CSPVHSRRRRWILPFSSTL*NLRTASLTFFFLCLIF 673
           C P  S  R + + FS+T   L  A +TF  + L F
Sbjct: 253 CRPTFSAARFYGIDFSNTFLGLVGAVVTFLIVLLQF 288


>EF127810-1|ABL67947.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           5 protein.
          Length = 311

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +1

Query: 457 LEGTYLFVVVFEDHRAMTLPAVVTVLHHR 543
           L GTY   ++F    ++ L  VV   HHR
Sbjct: 273 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>EF127809-1|ABL67946.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           4 protein.
          Length = 311

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +1

Query: 457 LEGTYLFVVVFEDHRAMTLPAVVTVLHHR 543
           L GTY   ++F    ++ L  VV   HHR
Sbjct: 273 LIGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>EF127808-1|ABL67945.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           3 protein.
          Length = 311

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +1

Query: 457 LEGTYLFVVVFEDHRAMTLPAVVTVLHHR 543
           L GTY   ++F    ++ L  VV   HHR
Sbjct: 273 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>EF127807-1|ABL67944.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           2 protein.
          Length = 311

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +1

Query: 457 LEGTYLFVVVFEDHRAMTLPAVVTVLHHR 543
           L GTY   ++F    ++ L  VV   HHR
Sbjct: 273 LLGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>EF127806-1|ABL67943.1|  311|Tribolium castaneum nicotinic
           acetylcholine receptor subunitalpha 6 transcript variant
           1 protein.
          Length = 311

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 11/29 (37%), Positives = 15/29 (51%)
 Frame = +1

Query: 457 LEGTYLFVVVFEDHRAMTLPAVVTVLHHR 543
           L GTY   ++F    ++ L  VV   HHR
Sbjct: 273 LIGTYFNCIMFMVASSVVLTVVVLNYHHR 301


>AY043292-1|AAK96031.1|  323|Tribolium castaneum homeodomain
           transcription factor Prothoraxlessprotein.
          Length = 323

 Score = 22.6 bits (46), Expect = 4.3
 Identities = 9/20 (45%), Positives = 9/20 (45%)
 Frame = +3

Query: 714 HHEASTPGGGWIPSGYCSPR 773
           HH    P GG  P G   PR
Sbjct: 63  HHYGGPPSGGQPPQGMPYPR 82


>EF592538-1|ABQ95984.1|  582|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG3 protein.
          Length = 582

 Score = 21.8 bits (44), Expect = 7.4
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = -3

Query: 125 EFTHLGVNTTRLSCW 81
           E  HLG +   L+CW
Sbjct: 364 ELFHLGSDEVNLTCW 378


>EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine
           vasopressin receptor protein.
          Length = 403

 Score = 21.4 bits (43), Expect = 9.8
 Identities = 11/21 (52%), Positives = 14/21 (66%)
 Frame = +1

Query: 742 GGFLLDIVVREGTSIFQLLSS 804
           GGFLL  VV+ G ++   LSS
Sbjct: 108 GGFLLCKVVKYGQTLGPYLSS 128


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 21.4 bits (43), Expect = 9.8
 Identities = 11/41 (26%), Positives = 19/41 (46%)
 Frame = +2

Query: 296 HIHKNRSCTSSMYNCFLIKEVSLQ*IKPTCELRHCVKILFK 418
           +I KN    +    C+ ++ V +  +   C L+H   IL K
Sbjct: 41  NIRKNGLNYNFTKKCYFLRMVLIDLLIVGCILKHIFNILMK 81


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 193,658
Number of Sequences: 336
Number of extensions: 4164
Number of successful extensions: 28
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 19
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 28
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24720487
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).