SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0020
         (788 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    27   0.23 
AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    25   0.69 
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    23   2.8  
DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7 prot...    23   3.7  
DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory pro...    22   4.9  
DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory pro...    22   4.9  
AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450 ...    22   4.9  
AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax pr...    22   6.4  
AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax pr...    22   6.4  
AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax pr...    22   6.4  
AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax pr...    22   6.4  
AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax pr...    22   6.4  
AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax pr...    22   6.4  
AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.           22   6.4  
AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduce...    22   6.4  
AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate neu...    21   8.5  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   8.5  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   8.5  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   8.5  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   8.5  

>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 26.6 bits (56), Expect = 0.23
 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%)
 Frame = +2

Query: 500 RCTRPVVPPVS-CWTPATVSPTPCPSTKDTHSP 595
           R  R VVPP   C  P+T+ P P     D++ P
Sbjct: 195 RSLRCVVPPTEDCDVPSTIPPPPPEEDDDSNIP 227


>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 25.0 bits (52), Expect = 0.69
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +1

Query: 301 IVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 396
           +VT+W + E+I++     +L V     PV+LT
Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILT 189


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 23.0 bits (47), Expect = 2.8
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -2

Query: 172 GTRREEHHLLRNRP 131
           G R+  HHL++N+P
Sbjct: 82  GVRKVLHHLIKNKP 95


>DQ659247-1|ABG47445.1|  980|Tribolium castaneum chitinase 7
           protein.
          Length = 980

 Score = 22.6 bits (46), Expect = 3.7
 Identities = 9/27 (33%), Positives = 13/27 (48%)
 Frame = +3

Query: 417 GQQREDDPDHVRNIQHARHVRRHPSRA 497
           GQ    DP+ V   +   H+  HP +A
Sbjct: 903 GQYTTKDPNEVTCDEEEGHISYHPDKA 929


>DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory
           protein 16 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -2

Query: 172 GTRREEHHLLRNRP 131
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory
           protein 9 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -2

Query: 172 GTRREEHHLLRNRP 131
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 127

 Score = 22.2 bits (45), Expect = 4.9
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +3

Query: 270 PDPQIPHRTRNRH 308
           PD  +P RT NRH
Sbjct: 110 PDNFLPERTANRH 122


>AY055847-1|AAL23667.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/46 (23%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP ++PS   +  +  +  P+S  T     P    ++++  SP  S
Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTTSQNLSSPASS 172


>AY055846-1|AAL26542.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/46 (23%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP ++PS   +  +  +  P+S  T     P    ++++  SP  S
Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172


>AY055845-1|AAL23670.2|  230|Tribolium castaneum cephalothorax
           protein.
          Length = 230

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/46 (23%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP ++PS   +  +  +  P+S  T     P    ++++  SP  S
Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172


>AF426396-1|AAL27023.2|  312|Tribolium castaneum cephalothorax
           protein.
          Length = 312

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/46 (23%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP ++PS   +  +  +  P+S  T     P    ++++  SP  S
Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172


>AF426395-1|AAL27022.2|  297|Tribolium castaneum cephalothorax
           protein.
          Length = 297

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/46 (23%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP ++PS   +  +  +  P+S  T     P    ++++  SP  S
Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172


>AF416773-1|AAL09697.1|  268|Tribolium castaneum cephalothorax
           protein.
          Length = 268

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/46 (23%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP ++PS   +  +  +  P+S  T     P    ++++  SP  S
Sbjct: 83  PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 128


>AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.
          Length = 312

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/46 (23%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP ++PS   +  +  +  P+S  T     P    ++++  SP  S
Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172


>AF227628-1|AAF42868.1|  312|Tribolium castaneum sex combs reduced
           Scr protein.
          Length = 312

 Score = 21.8 bits (44), Expect = 6.4
 Identities = 11/46 (23%), Positives = 21/46 (45%)
 Frame = +2

Query: 467 PPCTSPSKPCSRCTRPVVPPVSCWTPATVSPTPCPSTKDTHSPTPS 604
           PP ++PS   +  +  +  P+S  T     P    ++++  SP  S
Sbjct: 127 PPLSTPSNSNATKSSGLTSPLSVSTSPPGKPATSTASQNLSSPASS 172


>AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate
           neuroblasts defectiveprotein protein.
          Length = 224

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 8/24 (33%), Positives = 12/24 (50%)
 Frame = +3

Query: 561 HRAHLRRIRTPPRHPASGLSRSRP 632
           H+A +R +  PP+       RS P
Sbjct: 62  HKAPIRPVALPPKREIPSPKRSSP 85


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 339 MPNLLHVIPVSDDSVFD 289
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 339 MPNLLHVIPVSDDSVFD 289
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 339 MPNLLHVIPVSDDSVFD 289
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 8.5
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 339 MPNLLHVIPVSDDSVFD 289
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 195,845
Number of Sequences: 336
Number of extensions: 4821
Number of successful extensions: 26
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 26
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 26
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 21376414
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).