SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0019
         (837 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292383-1|CAL23195.2|  320|Tribolium castaneum gustatory recept...    22   5.2  
AM292358-1|CAL23170.2|  331|Tribolium castaneum gustatory recept...    22   5.2  
AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory recept...    22   5.2  
DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulati...    22   6.9  
AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosin...    22   6.9  
AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain tran...    21   9.1  
AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory recept...    21   9.1  
AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory recept...    21   9.1  
AF230313-1|AAF64147.1|  210|Tribolium castaneum labial protein p...    21   9.1  
AF230312-1|AAF64146.1|  253|Tribolium castaneum labial protein p...    21   9.1  

>AM292383-1|CAL23195.2|  320|Tribolium castaneum gustatory receptor
           candidate 62 protein.
          Length = 320

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = -1

Query: 795 LINVLITMYSV-LIRRTSEQRRVWCKLL 715
           +++V++ + +V  I  T  +R  WCKLL
Sbjct: 63  ILDVILLILNVHTILTTITKRNQWCKLL 90


>AM292358-1|CAL23170.2|  331|Tribolium castaneum gustatory receptor
           candidate 37 protein.
          Length = 331

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = -1

Query: 795 LINVLITMYSV-LIRRTSEQRRVWCKLL 715
           +++V++ + +V  I  T  +R  WCKLL
Sbjct: 63  ILDVILLILNVHTILTTITKRNQWCKLL 90


>AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory receptor
           candidate 32 protein.
          Length = 651

 Score = 22.2 bits (45), Expect = 5.2
 Identities = 10/28 (35%), Positives = 18/28 (64%), Gaps = 1/28 (3%)
 Frame = -1

Query: 795 LINVLITMYSV-LIRRTSEQRRVWCKLL 715
           +++V++ + +V  I  T  +R  WCKLL
Sbjct: 383 ILDVILLILNVHTILTTITKRNQWCKLL 410


>DQ490059-1|ABF22614.1|  947|Tribolium castaneum short gastrulation
           protein.
          Length = 947

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 7/17 (41%), Positives = 12/17 (70%)
 Frame = +1

Query: 454 EEDYVPHEVIRIVEPSY 504
           E+ Y+  EV+R+ +P Y
Sbjct: 337 EKKYILQEVVRVKKPHY 353


>AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosine
           kinase Torso-likeprotein protein.
          Length = 803

 Score = 21.8 bits (44), Expect = 6.9
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = +1

Query: 166 DLLDNYMVAEDPFLGPGKNQKLTLFKEIRSVKPDTM 273
           DL+ NY +A    + P  + K  +F  I   K +++
Sbjct: 298 DLIPNYYIAHFINIDPENHNKTEIFLNITGDKTNSV 333


>AY043293-2|AAK96034.1|  353|Tribolium castaneum homeodomain
           transcription factor Labialprotein.
          Length = 353

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = -1

Query: 384 EVHVHHLLVVYNGEAVLNKTGPSFT 310
           EV+ HH  +  +   +  +TG S+T
Sbjct: 62  EVYYHHQTIPQDNPIINTETGLSYT 86


>AM292376-1|CAL23188.2|  402|Tribolium castaneum gustatory receptor
           candidate 55 protein.
          Length = 402

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 14/55 (25%), Positives = 25/55 (45%)
 Frame = -2

Query: 380 YTSITSWSFTMGKLSSTKRVQVSRKNSLPLQLTINFMVSGFTLRISLKRVSFWFL 216
           Y S    S+T+  + S  R+  +  NSL +   + F+     + ++L    F FL
Sbjct: 57  YFSFYITSYTLLSVYSLFRIATNENNSLVINKRLIFIECFVMMALTLIVTLFTFL 111


>AM292332-1|CAL23144.2|  344|Tribolium castaneum gustatory receptor
           candidate 11 protein.
          Length = 344

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 14/55 (25%), Positives = 25/55 (45%)
 Frame = -2

Query: 380 YTSITSWSFTMGKLSSTKRVQVSRKNSLPLQLTINFMVSGFTLRISLKRVSFWFL 216
           Y S    S+T+  + S  R+  +  NSL +   + F+     + ++L    F FL
Sbjct: 57  YFSFYITSYTLLSVYSLFRIATNENNSLVINKRLIFIECFVMMALTLIVTLFTFL 111


>AF230313-1|AAF64147.1|  210|Tribolium castaneum labial protein
           protein.
          Length = 210

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = -1

Query: 384 EVHVHHLLVVYNGEAVLNKTGPSFT 310
           EV+ HH  +  +   +  +TG S+T
Sbjct: 62  EVYYHHQTIPQDNPIINTETGLSYT 86


>AF230312-1|AAF64146.1|  253|Tribolium castaneum labial protein
           protein.
          Length = 253

 Score = 21.4 bits (43), Expect = 9.1
 Identities = 8/25 (32%), Positives = 14/25 (56%)
 Frame = -1

Query: 384 EVHVHHLLVVYNGEAVLNKTGPSFT 310
           EV+ HH  +  +   +  +TG S+T
Sbjct: 62  EVYYHHQTIPQDNPIINTETGLSYT 86


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 206,358
Number of Sequences: 336
Number of extensions: 4916
Number of successful extensions: 16
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23036718
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).