SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0016
         (985 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2 ...    25   0.68 
AY052624-1|AAL15472.1|  212|Tribolium castaneum kynurenine 3-mon...    22   6.3  
AY052623-1|AAL15471.1|  101|Tribolium castaneum kynurenine 3-mon...    22   6.3  
AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine 3-mon...    22   6.3  
AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine 3-mon...    22   6.3  
AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine 3-mon...    22   6.3  
X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       22   8.4  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   8.4  

>AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2
           protein protein.
          Length = 301

 Score = 25.4 bits (53), Expect = 0.68
 Identities = 10/24 (41%), Positives = 15/24 (62%)
 Frame = +1

Query: 682 NNPTYRTSCPNPTPTGASHQRDNP 753
           NN +  +S  +P+ T A H RD+P
Sbjct: 163 NNTSTSSSASSPSVTAAPHLRDSP 186


>AY052624-1|AAL15472.1|  212|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 212

 Score = 22.2 bits (45), Expect = 6.3
 Identities = 11/41 (26%), Positives = 19/41 (46%)
 Frame = +2

Query: 35  GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 157
           G  E++     ++     T  DAVP+   D + N+   +KP
Sbjct: 8   GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 48


>AY052623-1|AAL15471.1|  101|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 101

 Score = 22.2 bits (45), Expect = 6.3
 Identities = 11/41 (26%), Positives = 19/41 (46%)
 Frame = +2

Query: 35  GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 157
           G  E++     ++     T  DAVP+   D + N+   +KP
Sbjct: 23  GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 63


>AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 290

 Score = 22.2 bits (45), Expect = 6.3
 Identities = 11/41 (26%), Positives = 19/41 (46%)
 Frame = +2

Query: 35  GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 157
           G  E++     ++     T  DAVP+   D + N+   +KP
Sbjct: 241 GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 281


>AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 22.2 bits (45), Expect = 6.3
 Identities = 11/41 (26%), Positives = 19/41 (46%)
 Frame = +2

Query: 35  GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 157
           G  E++     ++     T  DAVP+   D + N+   +KP
Sbjct: 241 GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 281


>AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 22.2 bits (45), Expect = 6.3
 Identities = 11/41 (26%), Positives = 19/41 (46%)
 Frame = +2

Query: 35  GIIENVEREETIEPELSDTLSDAVPINVVDPITNNHINLKP 157
           G  E++     ++     T  DAVP+   D + N+   +KP
Sbjct: 241 GKFESLRNAAELKDFYYKTFPDAVPLIGEDLLVNDFFKVKP 281


>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 19/71 (26%), Positives = 30/71 (42%), Gaps = 5/71 (7%)
 Frame = +2

Query: 572 GICSWKD-HSSYLSAETPSDSLDSNAEALQASATEDILTTLPTEPVVQ----TPPLQEPA 736
           G+ S  D HSS  S++T  D L  + ++ Q        T +           TPP  EP 
Sbjct: 56  GVTSGSDFHSSSPSSDTSQD-LQHSYQSPQTQPARFYSTPIVPHFAYNHNPLTPPNSEPL 114

Query: 737 INETTRRTPKD 769
           ++  + +  KD
Sbjct: 115 VSPKSEKEEKD 125


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.8 bits (44), Expect = 8.4
 Identities = 9/28 (32%), Positives = 12/28 (42%)
 Frame = -3

Query: 824  LFEHPLSRLAVFQYR*TSHPWVSFGLSR 741
            ++ HP    A F    T H W+  G  R
Sbjct: 2031 MYAHPEDADATFNTNFTIHYWIEKGADR 2058


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 202,976
Number of Sequences: 336
Number of extensions: 4121
Number of successful extensions: 14
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 27926910
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).