SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0015
         (721 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock prote...    23   1.9  
AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1 ...    23   1.9  
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    23   3.3  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    23   3.3  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    23   3.3  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    23   3.3  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    23   3.3  
AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory recept...    22   4.4  

>AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock protein
           70 protein.
          Length = 195

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 11/44 (25%), Positives = 22/44 (50%)
 Frame = +2

Query: 422 DLDETLVHSSFKPINNAHFVVPVEIDGAVHQVYVLKRPHVDEFL 553
           D  ETL  + F+ +NN  F+  ++    V +   + +  +DE +
Sbjct: 119 DFSETLTRAKFEELNNDQFLKTLKPVKKVLEDADMTKDQIDEIV 162


>AJ223627-1|CAA11500.1|  371|Tribolium castaneum orthodenticle-1
           protein protein.
          Length = 371

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 8/19 (42%), Positives = 12/19 (63%)
 Frame = -3

Query: 209 PKGVDPETGVPSPSLCCTP 153
           P+ V   TG+P+PS   +P
Sbjct: 215 PRSVATPTGIPTPSTSASP 233


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 19/65 (29%), Positives = 25/65 (38%)
 Frame = -2

Query: 366 SGGMFRHDQQGRRSPAVDTIGAIASGRSLASATAPTAQQRSQEAAGPARFLPTQRGRPRN 187
           SG     D      P   T+GA     +  SA +PTA      A G    +P+ R + R 
Sbjct: 231 SGQHLLQDTYKSMLPGAQTVGASFGLHATGSAPSPTA-----GAGGLPPQVPSPRSQRRY 285

Query: 186 WGAVT 172
            G  T
Sbjct: 286 TGRAT 290


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
            variant 2 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +3

Query: 6    MVLKFYRNSVAVCIKAKNKCINGRI 80
            +V + +RNSVA  I AK+   NG +
Sbjct: 1501 VVARNHRNSVASSIPAKDVFENGHV 1525


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
            variant 1 protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +3

Query: 6    MVLKFYRNSVAVCIKAKNKCINGRI 80
            +V + +RNSVA  I AK+   NG +
Sbjct: 1501 VVARNHRNSVASSIPAKDVFENGHV 1525


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B
            protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +3

Query: 6    MVLKFYRNSVAVCIKAKNKCINGRI 80
            +V + +RNSVA  I AK+   NG +
Sbjct: 1501 VVARNHRNSVASSIPAKDVFENGHV 1525


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A
            protein.
          Length = 1558

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 11/25 (44%), Positives = 16/25 (64%)
 Frame = +3

Query: 6    MVLKFYRNSVAVCIKAKNKCINGRI 80
            +V + +RNSVA  I AK+   NG +
Sbjct: 1501 VVARNHRNSVASSIPAKDVFENGHV 1525


>AM292348-1|CAL23160.2|  346|Tribolium castaneum gustatory receptor
           candidate 27 protein.
          Length = 346

 Score = 22.2 bits (45), Expect = 4.4
 Identities = 9/29 (31%), Positives = 13/29 (44%)
 Frame = -2

Query: 465 FIGLNELCTNVSSKSITMTLFMHVLVSHW 379
           F  L  LC  +   S+T  L+  +   HW
Sbjct: 258 FCSLVALCLTMYKLSLTEDLYFAIYEMHW 286


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 171,566
Number of Sequences: 336
Number of extensions: 4069
Number of successful extensions: 16
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 16
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19155320
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).