SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0013
         (823 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicas...    23   3.9  
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    22   6.8  
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   6.8  

>AY887136-1|AAW78361.1|  580|Tribolium castaneum vasa RNA helicase
           protein.
          Length = 580

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 11/28 (39%), Positives = 13/28 (46%)
 Frame = +2

Query: 725 LFQK*SVAGPRR*HGSATASATSLGTRE 808
           LFQ      PR  HG  T + T+  T E
Sbjct: 38  LFQLSETTAPRSIHGGTTVTITATQTGE 65


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -1

Query: 625 SGVLSVPCPSGFYQD 581
           SG+ ++ CP+G Y D
Sbjct: 68  SGLQAIRCPAGLYFD 82


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 21.8 bits (44), Expect = 6.8
 Identities = 12/43 (27%), Positives = 14/43 (32%)
 Frame = +1

Query: 529  PDIEEEEGFVPVISHGRRPGKNRRDRERKAPPRAHKTPQQHAD 657
            P I+EE   V  +   R             PP  H T Q   D
Sbjct: 1776 PPIDEEPPSVEAVEEEREEAPPSVHSSTVVPPPQHSTTQSLVD 1818


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 183,320
Number of Sequences: 336
Number of extensions: 3665
Number of successful extensions: 5
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22517873
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).