SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0011
         (939 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory recept...    26   0.37 
AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory recept...    26   0.37 
AM292351-1|CAL23163.2|  394|Tribolium castaneum gustatory recept...    23   2.6  
AM292350-1|CAL23162.2|  429|Tribolium castaneum gustatory recept...    23   2.6  
AM292328-1|CAL23140.2|  429|Tribolium castaneum gustatory recept...    23   2.6  
U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse ...    22   6.0  

>AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory receptor
           candidate 9 protein.
          Length = 408

 Score = 26.2 bits (55), Expect = 0.37
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +1

Query: 757 LLERCSVEENKIISGLETSEENMRGFAMFLAEI 855
           L+E   V+ NK++  LE +     GF  FL  +
Sbjct: 163 LVEHILVQTNKLVLALECNNTTAEGFTYFLGNM 195


>AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory receptor
           candidate 2 protein.
          Length = 587

 Score = 26.2 bits (55), Expect = 0.37
 Identities = 11/33 (33%), Positives = 17/33 (51%)
 Frame = +1

Query: 757 LLERCSVEENKIISGLETSEENMRGFAMFLAEI 855
           L+E   V+ NK++  LE +     GF  FL  +
Sbjct: 163 LVEHILVQTNKLVLALECNNTTAEGFTYFLGNM 195


>AM292351-1|CAL23163.2|  394|Tribolium castaneum gustatory receptor
           candidate 30 protein.
          Length = 394

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = +1

Query: 757 LLERCSVEENKIISGLETSEENMRGFAMFLAEIILS 864
           L+E   ++ NK++  LE +     GF  F  ++  S
Sbjct: 165 LIEYILMQTNKLVLALECNNSTSEGFDYFFGKMSYS 200


>AM292350-1|CAL23162.2|  429|Tribolium castaneum gustatory receptor
           candidate 29 protein.
          Length = 429

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = +1

Query: 757 LLERCSVEENKIISGLETSEENMRGFAMFLAEIILS 864
           L+E   ++ NK++  LE +     GF  F  ++  S
Sbjct: 165 LIEYILMQTNKLVLALECNNSTSEGFDYFFGKMSYS 200


>AM292328-1|CAL23140.2|  429|Tribolium castaneum gustatory receptor
           candidate 7 protein.
          Length = 429

 Score = 23.4 bits (48), Expect = 2.6
 Identities = 10/36 (27%), Positives = 18/36 (50%)
 Frame = +1

Query: 757 LLERCSVEENKIISGLETSEENMRGFAMFLAEIILS 864
           L+E   ++ NK++  LE +     GF  F  ++  S
Sbjct: 165 LIEYILMQTNKLVLALECNNSTSEGFDYFFGKMSYS 200


>U09586-2|AAC47271.1|  712|Tribolium castaneum protease, reverse
           transcriptase andRNase H protein.
          Length = 712

 Score = 22.2 bits (45), Expect = 6.0
 Identities = 12/45 (26%), Positives = 21/45 (46%)
 Frame = +2

Query: 698 VCVQCTIQWRNLRSLYSASACSSAVPLRKTRLSAAWKLQRRICVD 832
           V +QC ++ +    LY   A      ++ T L A W  ++R  +D
Sbjct: 149 VVIQCYLEIKIDEHLYPVVALVVKNLIKPTILGADWLNEQRAVID 193


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 234,686
Number of Sequences: 336
Number of extensions: 5665
Number of successful extensions: 13
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 26375415
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).