SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0007
         (818 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    25   0.72 
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    24   1.7  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    23   2.9  
AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    23   3.9  
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    22   5.1  
AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory recept...    22   5.1  
AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory recept...    22   5.1  
AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory recept...    22   6.7  
AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory recept...    21   8.9  

>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 25.0 bits (52), Expect = 0.72
 Identities = 8/28 (28%), Positives = 16/28 (57%)
 Frame = +2

Query: 188 YIILIYLFVHTKSFQYVLKKYIFKDLTV 271
           YI++   F H    +YV+  Y+ K++ +
Sbjct: 271 YIVMYVFFFHLSDVRYVMVVYLLKNVVL 298


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 23.8 bits (49), Expect = 1.7
 Identities = 12/36 (33%), Positives = 18/36 (50%)
 Frame = +2

Query: 188 YIILIYLFVHTKSFQYVLKKYIFKDLTVIKFNVVSN 295
           +I+LI  F+H KSF+  +      D T+ K     N
Sbjct: 95  FIMLIISFMHKKSFKNFVNNVAALDETLAKLGQYIN 130



 Score = 21.4 bits (43), Expect = 8.9
 Identities = 15/63 (23%), Positives = 26/63 (41%)
 Frame = +2

Query: 194 ILIYLFVHTKSFQYVLKKYIFKDLTVIKFNVVSNNILK*FLIKRGHIKNILTVSSIKFHV 373
           +L +L VH    Q+V    I K       N++ N   K  ++ +   K+     +I   +
Sbjct: 177 MLSFLMVHQGETQFVAANVILKTRFKTINNILENLWAKKLIVVKDKKKSRSDEQTIDICM 236

Query: 374 RIH 382
           R H
Sbjct: 237 RCH 239


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 23.0 bits (47), Expect = 2.9
 Identities = 8/13 (61%), Positives = 11/13 (84%)
 Frame = -3

Query: 72  NKTLIFSILKYYI 34
           N TL+FS+LK Y+
Sbjct: 352 NYTLVFSVLKQYV 364


>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 22.6 bits (46), Expect = 3.9
 Identities = 10/27 (37%), Positives = 17/27 (62%)
 Frame = +2

Query: 284 VVSNNILK*FLIKRGHIKNILTVSSIK 364
           +VSN +LK  + K  H KN +  S+++
Sbjct: 165 IVSNVVLKILVEKYRHQKNFINESNVE 191


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 14/33 (42%), Positives = 15/33 (45%)
 Frame = -3

Query: 711 QSRADLSCALFFMLNISAFHRLFRLQNTQRQYE 613
           QS  DLS  L F    S F R   LQN    Y+
Sbjct: 453 QSDLDLSRGLDFQPRGSVFVRFTHLQNQDFTYK 485


>AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory receptor
           candidate 45 protein.
          Length = 379

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = -1

Query: 734 AGNIMHATSRAQTYLARFFLC*IYPRSTDYF 642
           + NI+H T+     + +  LC I+  +T YF
Sbjct: 337 SANIVHITAGNYFEINKATLCGIFGTTTTYF 367


>AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory receptor
           candidate 8 protein.
          Length = 379

 Score = 22.2 bits (45), Expect = 5.1
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = -1

Query: 734 AGNIMHATSRAQTYLARFFLC*IYPRSTDYF 642
           + NI+H T+     + +  LC I+  +T YF
Sbjct: 337 SANIVHITAGNYFEINKATLCGIFGTTTTYF 367


>AM292374-1|CAL23186.2|  659|Tribolium castaneum gustatory receptor
           candidate 53 protein.
          Length = 659

 Score = 21.8 bits (44), Expect = 6.7
 Identities = 16/68 (23%), Positives = 28/68 (41%)
 Frame = -2

Query: 694 ILRAFFYVEYIRVPQIISTPEHAETI*TLVKTCAKASNFIIARFECTITSNILKIAMHTY 515
           I+R  F +    + + IS  +HAE +  L K+C           +   T  ++ + M T 
Sbjct: 184 IIRNRFVILNRYIEESISKYKHAELVMPLCKSCDLHHRLSKLIKQLNATYGLILLLMFTS 243

Query: 514 KLYIITLS 491
               I +S
Sbjct: 244 HFIFIVVS 251


>AM292326-1|CAL23138.2|  522|Tribolium castaneum gustatory receptor
           candidate 5 protein.
          Length = 522

 Score = 21.4 bits (43), Expect = 8.9
 Identities = 6/19 (31%), Positives = 13/19 (68%)
 Frame = -2

Query: 553 ITSNILKIAMHTYKLYIIT 497
           + +NI+ +  HTY+ ++ T
Sbjct: 115 VVTNIIFVLFHTYEAFVWT 133


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 178,139
Number of Sequences: 336
Number of extensions: 3882
Number of successful extensions: 10
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 10
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 22414104
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).