SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0006
         (852 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase rever...    25   0.76 
DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8 prot...    24   1.8  
EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2 p...    23   3.1  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   3.1  

>DQ372925-1|ABD17350.1|  596|Tribolium castaneum telomerase reverse
           transcriptase protein.
          Length = 596

 Score = 25.0 bits (52), Expect = 0.76
 Identities = 13/38 (34%), Positives = 18/38 (47%)
 Frame = +2

Query: 608 TYASKRLNVSCYLKLNRKILWQLSAQCSH*FYLHVARD 721
           +Y     N+  + K+  KIL Q S +C H   LH   D
Sbjct: 59  SYFGTTTNLKRFYKVVEKILTQSSFECIHLSVLHKCYD 96


>DQ659248-1|ABG47446.1|  496|Tribolium castaneum chitinase 8
           protein.
          Length = 496

 Score = 23.8 bits (49), Expect = 1.8
 Identities = 9/30 (30%), Positives = 14/30 (46%)
 Frame = +1

Query: 232 IDIVKMLITKLHSYLAPTEGDNVPIYVLSI 321
           +D + ++   LH       G N P+Y  SI
Sbjct: 203 LDFINVMAYDLHGSWESVTGQNAPLYASSI 232


>EF117815-1|ABO38438.1|  535|Tribolium castaneum cryptochrome 2
           protein.
          Length = 535

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 14/46 (30%), Positives = 23/46 (50%), Gaps = 1/46 (2%)
 Frame = +3

Query: 327 KKNLRPQ-FIPTFLILNVYVREPCLSLYFFGWQQSIQQSYLKKKTP 461
           +  + PQ  +P+   L+ Y+R  CLS   F +Q +     +KK  P
Sbjct: 250 RPKMTPQSLLPSQTGLSPYLRFGCLSTRLFYYQLTDLYKKIKKAFP 295


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 23.0 bits (47), Expect = 3.1
 Identities = 10/25 (40%), Positives = 12/25 (48%)
 Frame = +2

Query: 281 QQRAITFRFTYCPY*KKKPKATIYS 355
           Q   I F F YC Y  K  K  +Y+
Sbjct: 264 QFNTIVFSFCYCYYNSKMTKDGVYN 288


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 186,223
Number of Sequences: 336
Number of extensions: 4085
Number of successful extensions: 8
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23555563
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).