SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0005
         (881 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    27   0.20 
AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxida...    24   1.4  
S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Triboliu...    23   2.4  
AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory recept...    22   7.3  

>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 27.1 bits (57), Expect = 0.20
 Identities = 17/62 (27%), Positives = 27/62 (43%)
 Frame = +2

Query: 377 LEPITMHMSLQICLFIKFDKNKSEWPF*KEQFPNLIV*SLPHDRLTFEIVQIPKGSLTMI 556
           + P     +L + +  + D    + P   E FP+  V S    +   E   +P+GS T I
Sbjct: 118 VNPYLFSYALSVAILHRQDTQDIDLPSFIESFPDKYVDSKVFAKAREEATVVPEGSRTPI 177

Query: 557 EI 562
           EI
Sbjct: 178 EI 179


>AY884063-1|AAX84204.1|  682|Tribolium castaneum pro-phenol oxidase
           subunit 1 protein.
          Length = 682

 Score = 24.2 bits (50), Expect = 1.4
 Identities = 17/62 (27%), Positives = 26/62 (41%)
 Frame = +2

Query: 377 LEPITMHMSLQICLFIKFDKNKSEWPF*KEQFPNLIV*SLPHDRLTFEIVQIPKGSLTMI 556
           + P   + +  + L  + D    + P     FP+  V S    R   E   +P+GS T I
Sbjct: 118 VNPYLFYYAFSVALLHRPDTQNLDLPSFIHVFPDKYVDSQVFARAREEAHIVPEGSRTPI 177

Query: 557 EI 562
           EI
Sbjct: 178 EI 179


>S73225-1|AAB30811.1|  327|Tribolium castaneum protein ( Tribolium
           castaneum homeodomainprotein mRNA, complete cds. ).
          Length = 327

 Score = 23.4 bits (48), Expect = 2.4
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = -3

Query: 369 KTTDY*ILWPAWIKFASSSD 310
           KT    +LWPAW+     SD
Sbjct: 182 KTESQPMLWPAWVYCTRYSD 201


>AM292369-1|CAL23181.1|  408|Tribolium castaneum gustatory receptor
           candidate 48 protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 7.3
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = -2

Query: 379 KYIKNNRLLNSLASLDQICFFI*LFTSVYLF 287
           K  + N  ++ L  +   C+FI LFT  Y++
Sbjct: 130 KESERNDYVSLLQLVFVFCYFIYLFTVYYIY 160


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 199,338
Number of Sequences: 336
Number of extensions: 4525
Number of successful extensions: 5
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 24410188
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).