SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0004
         (717 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.          27   0.12 
AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock prote...    23   1.9  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    23   2.5  
EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate 1-deca...    23   3.3  
AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle nu...    22   5.7  

>DQ342040-1|ABC69932.1|  822|Tribolium castaneum STIP protein.
          Length = 822

 Score = 27.5 bits (58), Expect = 0.12
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 2/48 (4%)
 Frame = -1

Query: 405 STPYGSVDRSSPPSLPSNRCGSRNRS--TTSLAPPLYTGSASKRTARR 268
           S  Y S++ ++PP  P  R  S   +  T S  PPLY    +KR   R
Sbjct: 720 SISYLSMENNAPPPPPPPRVESFAETVRTVSKIPPLYKDLVAKRCEER 767


>AY769608-1|AAV40984.1|  195|Tribolium castaneum heat shock protein
           70 protein.
          Length = 195

 Score = 23.4 bits (48), Expect = 1.9
 Identities = 11/24 (45%), Positives = 13/24 (54%)
 Frame = -3

Query: 556 DVDIRKDLYANTVLSGGTTMYPGI 485
           D D+ KD     VL GG+T  P I
Sbjct: 150 DADMTKDQIDEIVLVGGSTRIPKI 173


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 23.0 bits (47), Expect = 2.5
 Identities = 12/32 (37%), Positives = 19/32 (59%), Gaps = 2/32 (6%)
 Frame = -1

Query: 363 LPSNRCGSRNRSTTSLAPPLYTGSA--SKRTA 274
           LP++RC SR  S + + P   +G +  S+R A
Sbjct: 79  LPNSRCNSRESSDSLVQPRCPSGESMLSERAA 110


>EU019709-1|ABU25221.1|  540|Tribolium castaneum aspartate
           1-decarboxylase protein.
          Length = 540

 Score = 22.6 bits (46), Expect = 3.3
 Identities = 7/17 (41%), Positives = 12/17 (70%)
 Frame = +2

Query: 383 STDPYGVLPLWRSNDLN 433
           + DPYG++  W ++ LN
Sbjct: 141 AVDPYGLVAQWATDALN 157


>AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle
           nuclear receptor protein.
          Length = 407

 Score = 21.8 bits (44), Expect = 5.7
 Identities = 13/34 (38%), Positives = 17/34 (50%)
 Frame = -1

Query: 366 SLPSNRCGSRNRSTTSLAPPLYTGSASKRTARRC 265
           SL S    + N+S+TS  PP +  S SK     C
Sbjct: 56  SLLSPSGNTPNKSSTSPYPPNHPLSGSKHLCSIC 89


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 170,939
Number of Sequences: 336
Number of extensions: 3912
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19051215
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).