SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= cesb0001
         (944 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory recept...    24   1.5  
AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory recept...    24   1.5  
X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.       23   3.5  
EF592537-1|ABQ95983.1|  593|Tribolium castaneum beta-N-acetylglu...    22   8.0  
AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxida...    22   8.0  

>AM292373-1|CAL23185.2|  360|Tribolium castaneum gustatory receptor
           candidate 52 protein.
          Length = 360

 Score = 24.2 bits (50), Expect = 1.5
 Identities = 34/144 (23%), Positives = 60/144 (41%), Gaps = 14/144 (9%)
 Frame = +3

Query: 18  FPDFILIN*RNLIFYCKFCLYYIVSNM*RILKQCYLRKVSNYVYVFQ-VDETLK-KKRIF 191
           +  +I  N   L FY +F + Y    +   +   +   V   +  ++ + + L+ K R F
Sbjct: 131 YMSYIFANIMGLEFYKQFAIEYFQMYVLFFVNFAFFVVVKMLLVRYRNLTKQLRFKLRFF 190

Query: 192 RKFTYRGVDLDQLLDMPKLVFLSVQYLKCSVSKKFEVKGFL*LFTVMFQTE--LLYVKYA 365
            K   R +   Q LD    +   +  LK  V    ++ G+  LF + + T   L+Y+  A
Sbjct: 191 EKLGNRRLGFVQRLDQ---IQFDICLLKEGVDLVNDIFGWQILFLITYATLQILVYLHLA 247

Query: 366 LM----------YIYYRLFWYGVS 407
           +M          YI   +FWY V+
Sbjct: 248 VMLGFQDIYMIVYIIVVIFWYTVN 271


>AM292353-1|CAL23165.2|  651|Tribolium castaneum gustatory receptor
           candidate 32 protein.
          Length = 651

 Score = 24.2 bits (50), Expect = 1.5
 Identities = 34/144 (23%), Positives = 60/144 (41%), Gaps = 14/144 (9%)
 Frame = +3

Query: 18  FPDFILIN*RNLIFYCKFCLYYIVSNM*RILKQCYLRKVSNYVYVFQ-VDETLK-KKRIF 191
           +  +I  N   L FY +F + Y    +   +   +   V   +  ++ + + L+ K R F
Sbjct: 131 YMSYIFANIMGLEFYKQFAIEYFQMYVLFFVNFAFFVVVKMLLVRYRNLTKQLRFKLRFF 190

Query: 192 RKFTYRGVDLDQLLDMPKLVFLSVQYLKCSVSKKFEVKGFL*LFTVMFQTE--LLYVKYA 365
            K   R +   Q LD    +   +  LK  V    ++ G+  LF + + T   L+Y+  A
Sbjct: 191 EKLGNRRLGFVQRLDQ---IQFDICLLKEGVDLVNDIFGWQILFLITYATLQILVYLHLA 247

Query: 366 LM----------YIYYRLFWYGVS 407
           +M          YI   +FWY V+
Sbjct: 248 VMLGFQDIYMIVYIIVVIFWYTVN 271


>X91618-1|CAA62821.1|  524|Tribolium castaneum hunchback protein.
          Length = 524

 Score = 23.0 bits (47), Expect = 3.5
 Identities = 13/35 (37%), Positives = 19/35 (54%)
 Frame = +2

Query: 566 APPNEKPEIVKTHLRNMIIVPEMVGSIVGIYNGKT 670
           A PN KP+  + HLR +    EM     G+++ KT
Sbjct: 134 ASPNRKPDDNQDHLRRL----EMSLEKSGLFSSKT 164


>EF592537-1|ABQ95983.1|  593|Tribolium castaneum
           beta-N-acetylglucosaminidase NAG2 protein.
          Length = 593

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 9/20 (45%), Positives = 11/20 (55%)
 Frame = -2

Query: 310 NPLTSNFFDTLHLRY*TLKN 251
           NP+  N FD L L Y  + N
Sbjct: 347 NPINPNVFDVLKLLYNDIVN 366


>AY884064-1|AAX84205.1|  683|Tribolium castaneum pro-phenol oxidase
           subunit 2 protein.
          Length = 683

 Score = 21.8 bits (44), Expect = 8.0
 Identities = 6/11 (54%), Positives = 10/11 (90%)
 Frame = -3

Query: 87  RYNTDKICNKI 55
           RYN +++CNK+
Sbjct: 242 RYNFERLCNKL 252


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 204,908
Number of Sequences: 336
Number of extensions: 4118
Number of successful extensions: 7
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 57
effective length of database: 103,433
effective search space used: 26582281
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).