SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0044
         (613 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory recept...    23   2.7  
AM292379-1|CAL23191.2|  376|Tribolium castaneum gustatory recept...    21   6.2  
AJ845189-1|CAH60166.1|  515|Tribolium castaneum putative esteras...    21   6.2  
AJ845188-1|CAH60165.1|  517|Tribolium castaneum putative esteras...    21   6.2  
AJ845187-1|CAH60164.1|  515|Tribolium castaneum esterase protein.      21   6.2  
AJ844897-1|CAH59956.1|  517|Tribolium castaneum esterase protein.      21   6.2  
AF260821-1|AAG02019.1|  134|Tribolium castaneum alpha-esterase l...    21   6.2  
X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Triboliu...    21   8.2  
U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II p...    21   8.2  

>AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory receptor
           candidate 1 protein.
          Length = 373

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 10/47 (21%), Positives = 24/47 (51%), Gaps = 1/47 (2%)
 Frame = +1

Query: 172 LHHLLYYIYIMNTHL*YTIVKLFCTVIFNNKHPVFEIQRG-IFLSFV 309
           + H +   ++ +  + +   ++FC V FN++   F + +   F +FV
Sbjct: 1   MQHEVVKKFLHSVRIVFVQSEIFCLVNFNHRESYFRLSKAKSFCTFV 47


>AM292379-1|CAL23191.2|  376|Tribolium castaneum gustatory receptor
           candidate 58 protein.
          Length = 376

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 9/20 (45%), Positives = 12/20 (60%)
 Frame = -2

Query: 144 YTRLEAKSLPTIV*LVLNVF 85
           Y R+ AK LPT+    L+ F
Sbjct: 153 YVRIAAKGLPTLKLFALHEF 172


>AJ845189-1|CAH60166.1|  515|Tribolium castaneum putative esterase
           protein.
          Length = 515

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 502 YNIESMSSA*CEFFNFYAIENVTKTR 579
           +N+ +  S  C F N Y  +N T ++
Sbjct: 71  FNLPAQGSEDCLFLNVYTPKNGTNSK 96


>AJ845188-1|CAH60165.1|  517|Tribolium castaneum putative esterase
           protein.
          Length = 517

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 502 YNIESMSSA*CEFFNFYAIENVTKTR 579
           +N+ +  S  C F N Y  +N T ++
Sbjct: 73  FNLPAQGSEDCLFLNVYTPKNGTNSK 98


>AJ845187-1|CAH60164.1|  515|Tribolium castaneum esterase protein.
          Length = 515

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 502 YNIESMSSA*CEFFNFYAIENVTKTR 579
           +N+ +  S  C F N Y  +N T ++
Sbjct: 71  FNLPAQGSEDCLFLNVYTPKNGTNSK 96


>AJ844897-1|CAH59956.1|  517|Tribolium castaneum esterase protein.
          Length = 517

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 502 YNIESMSSA*CEFFNFYAIENVTKTR 579
           +N+ +  S  C F N Y  +N T ++
Sbjct: 73  FNLPAQGSEDCLFLNVYTPKNGTNSK 98


>AF260821-1|AAG02019.1|  134|Tribolium castaneum alpha-esterase like
           protein E2 protein.
          Length = 134

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 8/26 (30%), Positives = 14/26 (53%)
 Frame = +1

Query: 502 YNIESMSSA*CEFFNFYAIENVTKTR 579
           +N+ +  S  C F N Y  +N T ++
Sbjct: 45  FNLPAQGSEDCLFLNVYTPKNGTNSK 70


>X06905-1|CAA30009.1|  489|Tribolium castaneum protein ( Tribolium
           castaneum mRNAfor alhpa amylase 3'region. ).
          Length = 489

 Score = 21.0 bits (42), Expect = 8.2
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 603 HLPTGVLIASFCNVL 559
           HL TG+   S+C+V+
Sbjct: 432 HLQTGLPAGSYCDVI 446


>U04271-2|AAA03709.1|  490|Tribolium castaneum alpha-amylase II
           protein.
          Length = 490

 Score = 21.0 bits (42), Expect = 8.2
 Identities = 7/15 (46%), Positives = 11/15 (73%)
 Frame = -2

Query: 603 HLPTGVLIASFCNVL 559
           HL TG+   S+C+V+
Sbjct: 433 HLQTGLPAGSYCDVI 447


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 134,493
Number of Sequences: 336
Number of extensions: 2728
Number of successful extensions: 12
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15561709
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).