SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0042
         (619 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine recombi...    23   1.6  
AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembran...    21   6.3  
AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembran...    21   6.3  
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    21   8.3  
AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory recept...    21   8.3  

>AY531876-2|AAT08871.1|  340|Tribolium castaneum tyrosine
           recombinase protein.
          Length = 340

 Score = 23.4 bits (48), Expect = 1.6
 Identities = 23/79 (29%), Positives = 34/79 (43%), Gaps = 11/79 (13%)
 Frame = +2

Query: 170 KLHWPFDCRVGHRCPTRRTEVIMSISVTRRLHGLLL-FVNVCFSLIDLL---EI------ 319
           KL W F  R GH C     + I++    R   G     +N C S + LL   E+      
Sbjct: 58  KLWWEFCQRNGHNCLDFTVQNILTFLSCRFHQGASYNTLNTCRSALALLLSPEVGKDHRI 117

Query: 320 -RFILSIVRIRLSQSLLDI 373
            RF+  + RI+ S+   D+
Sbjct: 118 KRFLRGVYRIKPSKPKYDV 136


>AF442747-1|AAL40947.1|  669|Tribolium castaneum ABC transmembrane
           transporter protein.
          Length = 669

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -2

Query: 534 IITVWHNVCNIRC 496
           +I  W NV NI+C
Sbjct: 602 MINQWENVTNIQC 614


>AF422804-1|AAL56571.1|  669|Tribolium castaneum ABC transmembrane
           transporter white protein.
          Length = 669

 Score = 21.4 bits (43), Expect = 6.3
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = -2

Query: 534 IITVWHNVCNIRC 496
           +I  W NV NI+C
Sbjct: 602 MINQWENVTNIQC 614


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 8/20 (40%), Positives = 12/20 (60%)
 Frame = +2

Query: 527 VIIWDKG*KAQIFFTVKLIF 586
           ++IW    + QIF T +L F
Sbjct: 121 MLIWKSYKRTQIFITCELFF 140


>AM292354-1|CAL23166.1|  321|Tribolium castaneum gustatory receptor
           candidate 33 protein.
          Length = 321

 Score = 21.0 bits (42), Expect = 8.3
 Identities = 8/27 (29%), Positives = 15/27 (55%)
 Frame = +3

Query: 447 NIYSALIFIFRDNKIPRI*YCIHYARQ 527
           N+Y  L+F+     +  + Y ++Y RQ
Sbjct: 98  NLYYLLLFVINVLYVLTLCYAVYYWRQ 124


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 143,977
Number of Sequences: 336
Number of extensions: 3279
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15770591
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).