SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0039
         (616 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    25   0.51 
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    23   2.0  
AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle nu...    23   2.7  
DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory pro...    22   3.6  
DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory pro...    22   3.6  
AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450 ...    22   3.6  
AF017415-1|AAB70262.1|  343|Tribolium castaneum abdominal-AII pr...    22   3.6  
AF017414-1|AAB70260.1|  209|Tribolium castaneum abdominal-AII pr...    22   3.6  
DQ855504-1|ABH88191.1|  124|Tribolium castaneum chemosensory pro...    22   4.7  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   6.2  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   6.2  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   6.2  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   6.2  
AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.     21   8.2  

>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 25.0 bits (52), Expect = 0.51
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +3

Query: 318 IVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 413
           +VT+W + E+I++     +L V     PV+LT
Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILT 189


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -1

Query: 190 GTRREEHHLLRNRP 149
           G R+  HHL++N+P
Sbjct: 82  GVRKVLHHLIKNKP 95


>AM295014-1|CAL25729.1|  407|Tribolium castaneum ultraspiracle
           nuclear receptor protein.
          Length = 407

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 8/20 (40%), Positives = 13/20 (65%)
 Frame = -1

Query: 265 SSPTKSPSVPYRPSRPDGGA 206
           ++P KS + PY P+ P  G+
Sbjct: 63  NTPNKSSTSPYPPNHPLSGS 82


>DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory
           protein 16 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -1

Query: 190 GTRREEHHLLRNRP 149
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory
           protein 9 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -1

Query: 190 GTRREEHHLLRNRP 149
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 127

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +2

Query: 287 PDPQIPHRTRNRH 325
           PD  +P RT NRH
Sbjct: 110 PDNFLPERTANRH 122


>AF017415-1|AAB70262.1|  343|Tribolium castaneum abdominal-AII
           protein.
          Length = 343

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = +1

Query: 469 KHSTRPPCTSPSKRALAVRVRSYHRYRAGLPATG 570
           +HS+    TSP+ R       ++H ++A   A G
Sbjct: 46  QHSSSSASTSPAARMYPYVSAAHHHHQAAAAAFG 79


>AF017414-1|AAB70260.1|  209|Tribolium castaneum abdominal-AII
           protein.
          Length = 209

 Score = 22.2 bits (45), Expect = 3.6
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = +1

Query: 469 KHSTRPPCTSPSKRALAVRVRSYHRYRAGLPATG 570
           +HS+    TSP+ R       ++H ++A   A G
Sbjct: 46  QHSSSSASTSPAARMYPYVSAAHHHHQAAAAAFG 79


>DQ855504-1|ABH88191.1|  124|Tribolium castaneum chemosensory
           protein 18 protein.
          Length = 124

 Score = 21.8 bits (44), Expect = 4.7
 Identities = 13/52 (25%), Positives = 22/52 (42%)
 Frame = +3

Query: 192 LDRGKAPPSGRDGRYGTEGLLVGDEAQSKRGILTLKYPIEHGIVTNWDDMEK 347
           LD+G+  P G+  +      L  D A+    +      + H ++ N  DM K
Sbjct: 46  LDKGRCTPEGKKLKSTIPEALSTDCAKCNEKVKANVRKVLHHLIDNKPDMWK 97


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 356 MPNLLHVIPVSDDSVFD 306
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 356 MPNLLHVIPVSDDSVFD 306
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 356 MPNLLHVIPVSDDSVFD 306
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.2
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -3

Query: 356 MPNLLHVIPVSDDSVFD 306
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.
          Length = 301

 Score = 21.0 bits (42), Expect = 8.2
 Identities = 9/27 (33%), Positives = 16/27 (59%)
 Frame = -1

Query: 292 VRIPLLLCASSPTKSPSVPYRPSRPDG 212
           +++P    A S   SP++P+  +R DG
Sbjct: 117 MQLPHPAAAHSALLSPAMPHNLTRHDG 143


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 162,714
Number of Sequences: 336
Number of extensions: 3913
Number of successful extensions: 17
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 17
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 17
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15666150
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).