SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0036
         (602 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine 3-mon...    25   0.65 
AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine 3-mon...    25   0.65 
AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine 3-mon...    25   0.65 
DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    24   1.1  
AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr...    23   2.0  
AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory recept...    22   4.6  
AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory recept...    22   4.6  
EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    21   6.1  
AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.       21   6.1  

>AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 290

 Score = 24.6 bits (51), Expect = 0.65
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +3

Query: 303 RRYLRLSKMFELKQTLADGRYL 368
           RRY++L+ +FE  QT     YL
Sbjct: 174 RRYMQLTPLFEYSQTYIQHGYL 195


>AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 24.6 bits (51), Expect = 0.65
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +3

Query: 303 RRYLRLSKMFELKQTLADGRYL 368
           RRY++L+ +FE  QT     YL
Sbjct: 174 RRYMQLTPLFEYSQTYIQHGYL 195


>AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 24.6 bits (51), Expect = 0.65
 Identities = 10/22 (45%), Positives = 14/22 (63%)
 Frame = +3

Query: 303 RRYLRLSKMFELKQTLADGRYL 368
           RRY++L+ +FE  QT     YL
Sbjct: 174 RRYMQLTPLFEYSQTYIQHGYL 195


>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 23.8 bits (49), Expect = 1.1
 Identities = 12/42 (28%), Positives = 17/42 (40%)
 Frame = +2

Query: 350  CRRPLSRRREACWPAAPVRSSDVSAPCHSGWSDPSTSRRWRT 475
            C  P S + E   P     +S    P    +  PST+  W+T
Sbjct: 1144 CDWPKSAKCEEKKPGHKPSTSSWQKPTKPSYRPPSTTNHWQT 1185


>AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like
           protein protein.
          Length = 1156

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 13/37 (35%), Positives = 18/37 (48%)
 Frame = +1

Query: 268 SRSHIPPSSSTRDDI*G*AKCSSSSRRLPTAVISSTR 378
           S + +PP S TRD      K  S  +R P+    ST+
Sbjct: 676 SNNILPPESPTRDKSKQNEKSPSPQQRSPSVTDLSTK 712


>AM292330-1|CAL23142.2|  408|Tribolium castaneum gustatory receptor
           candidate 9 protein.
          Length = 408

 Score = 21.8 bits (44), Expect = 4.6
 Identities = 7/28 (25%), Positives = 15/28 (53%)
 Frame = -2

Query: 334 SNILLNLKYRLAWKSWAEYGSDWCSLRA 251
           + ++ +L +    K W ++  DWC + A
Sbjct: 94  TGVMASLLFLNLAKRWPKFVKDWCVVDA 121


>AM292323-1|CAL23135.2|  587|Tribolium castaneum gustatory receptor
           candidate 2 protein.
          Length = 587

 Score = 21.8 bits (44), Expect = 4.6
 Identities = 7/28 (25%), Positives = 15/28 (53%)
 Frame = -2

Query: 334 SNILLNLKYRLAWKSWAEYGSDWCSLRA 251
           + ++ +L +    K W ++  DWC + A
Sbjct: 94  TGVMASLLFLNLAKRWPKFVKDWCVVDA 121


>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 21.4 bits (43), Expect = 6.1
 Identities = 9/18 (50%), Positives = 9/18 (50%)
 Frame = +1

Query: 256 EDCTSRSHIPPSSSTRDD 309
           EDC   S IPP     DD
Sbjct: 205 EDCDVPSTIPPPPPEEDD 222


>AF225975-1|AAF74117.1|  256|Tribolium castaneum unknown protein.
          Length = 256

 Score = 21.4 bits (43), Expect = 6.1
 Identities = 10/32 (31%), Positives = 17/32 (53%)
 Frame = +3

Query: 204 GCTAVVEPLPATCFPSARRLHQSLPYSAQLFH 299
           G  A V+PLP    P + +LH  + +   ++H
Sbjct: 23  GYPASVQPLPRHFNPPSDKLHHPI-HQTVIYH 53


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 128,535
Number of Sequences: 336
Number of extensions: 2522
Number of successful extensions: 9
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15248386
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).