SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0035
         (392 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.     24   0.62 
AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450 ...    22   1.9  
U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.           22   2.5  
U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.     21   4.4  
U81038-1|AAB39355.1|  412|Tribolium castaneum transcription fact...    21   4.4  
AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.           21   4.4  
AY584475-1|AAS93634.1|  209|Tribolium castaneum homothorax protein.    21   5.8  
AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.    21   5.8  
AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor ...    21   5.8  
AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6 prot...    20   7.6  
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    20   7.6  

>AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.
          Length = 301

 Score = 23.8 bits (49), Expect = 0.62
 Identities = 17/65 (26%), Positives = 29/65 (44%)
 Frame = -2

Query: 298 SPSVPYRPSRPDGGASHDRGKHCARSIISCEAGLAHTGAIVYYQRGNFFVAHLELVKLVR 119
           SP++P+  +R DG    ++G     +I    +G+       Y       V HLE ++  R
Sbjct: 131 SPAMPHNLTRHDGSVIKNQGMPTMEAI--ARSGIWENCRAAYED----IVKHLERLREER 184

Query: 118 CRCDK 104
           C  D+
Sbjct: 185 CDPDR 189


>AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 127

 Score = 22.2 bits (45), Expect = 1.9
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +3

Query: 336 PDPQIPHRTRNRH 374
           PD  +P RT NRH
Sbjct: 110 PDNFLPERTANRH 122


>U09586-1|AAC47270.1|  425|Tribolium castaneum ORF 1 protein.
          Length = 425

 Score = 21.8 bits (44), Expect = 2.5
 Identities = 10/26 (38%), Positives = 13/26 (50%)
 Frame = -2

Query: 130 KLVRCRCDKMKIKRPAVTANREKQIP 53
           K  R   D+ ++ RPA  ANR    P
Sbjct: 330 KRPRPNIDRHEVTRPAAPANRGNGFP 355


>U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.
          Length = 283

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = -2

Query: 88  PAVTANREKQIPDCRPGAGTPAPGILPAG 2
           P VT N + +   C PG+G       P+G
Sbjct: 137 PNVTPNCDVKSSVCSPGSGHQDSRTSPSG 165


>U81038-1|AAB39355.1|  412|Tribolium castaneum transcription factor
           Deformed protein.
          Length = 412

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = -2

Query: 88  PAVTANREKQIPDCRPGAGTPAPGILPAG 2
           P VT N + +   C PG+G       P+G
Sbjct: 137 PNVTPNCDVKSSVCSPGSGHQDSRTSPSG 165


>AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.
          Length = 412

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = -2

Query: 88  PAVTANREKQIPDCRPGAGTPAPGILPAG 2
           P VT N + +   C PG+G       P+G
Sbjct: 137 PNVTPNCDVKSSVCSPGSGHQDSRTSPSG 165


>AY584475-1|AAS93634.1|  209|Tribolium castaneum homothorax protein.
          Length = 209

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 7/39 (17%)
 Frame = +3

Query: 177 TMAPVCARPASQDMMLLAQ-------CFPRSWEAPPSGR 272
           T  P+   PASQ  +  +        C  R W +PP  R
Sbjct: 94  TPGPLSQAPASQQSLDASDPDAMGKWCPRREWSSPPDAR 132


>AJ518941-1|CAD57735.1|  456|Tribolium castaneum homothorax protein.
          Length = 456

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 12/39 (30%), Positives = 16/39 (41%), Gaps = 7/39 (17%)
 Frame = +3

Query: 177 TMAPVCARPASQDMMLLAQ-------CFPRSWEAPPSGR 272
           T  P+   PASQ  +  +        C  R W +PP  R
Sbjct: 250 TPGPLSQAPASQQSLDASDPDAMGKWCPRREWSSPPDAR 288


>AJ005083-1|CAB65469.1|  585|Tribolium castaneum signal receptor
           protein protein.
          Length = 585

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -2

Query: 67  EKQIPDCRPGA 35
           E  + DCRPGA
Sbjct: 258 EINVDDCRPGA 268


>AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6
           protein.
          Length = 377

 Score = 20.2 bits (40), Expect = 7.6
 Identities = 12/40 (30%), Positives = 17/40 (42%)
 Frame = +2

Query: 152 EEVAALVVDNGSGMCKAGFAGYDAPRAVFPSIVGSPAIRA 271
           ++VAAL   N +        GY A  A F ++      RA
Sbjct: 81  QKVAALKKTNPALKALFSLGGYAAGTATFTAVAADATKRA 120


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 20.2 bits (40), Expect = 7.6
 Identities = 10/23 (43%), Positives = 12/23 (52%)
 Frame = +3

Query: 219 MLLAQCFPRSWEAPPSGRDGRYG 287
           ML AQC   S ++PP   D   G
Sbjct: 39  MLAAQCNKLSNKSPPPLADAAVG 61


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 98,899
Number of Sequences: 336
Number of extensions: 2024
Number of successful extensions: 13
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 13
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 13
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  8330471
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).