SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0031
         (558 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain tran...    22   4.1  
AM292377-1|CAL23189.2|  358|Tribolium castaneum gustatory recept...    22   4.1  
AM292342-1|CAL23154.2|  386|Tribolium castaneum gustatory recept...    22   4.1  
AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia or...    22   4.1  
AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia or...    22   4.1  
AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory recept...    21   5.4  
AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory recept...    21   5.4  
AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2 prot...    21   7.2  
AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.           21   7.2  
EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine vasopre...    21   9.5  
AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine 3-mon...    21   9.5  
AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine 3-mon...    21   9.5  
AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine 3-mon...    21   9.5  
AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2 ...    21   9.5  

>AY043293-1|AAK96033.1|  523|Tribolium castaneum homeodomain
           transcription factor Maxillopediaprotein.
          Length = 523

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = -2

Query: 350 NSLPSKLG*GVNFGDGSYGASS 285
           N+ PS      NF + S GASS
Sbjct: 129 NNTPSATNNNTNFNNNSNGASS 150


>AM292377-1|CAL23189.2|  358|Tribolium castaneum gustatory
          receptor candidate 56 protein.
          Length = 358

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = +1

Query: 31 NGSEVFSFLWASLT 72
          NG +VF F W  LT
Sbjct: 42 NGKKVFKFAWWPLT 55


>AM292342-1|CAL23154.2|  386|Tribolium castaneum gustatory
          receptor candidate 21 protein.
          Length = 386

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 8/14 (57%), Positives = 9/14 (64%)
 Frame = +1

Query: 31 NGSEVFSFLWASLT 72
          NG +VF F W  LT
Sbjct: 42 NGKKVFKFAWWPLT 55


>AF187069-1|AAF03889.1|  471|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 471

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = -2

Query: 350 NSLPSKLG*GVNFGDGSYGASS 285
           N+ PS      NF + S GASS
Sbjct: 77  NNTPSATNNNTNFNNNSNGASS 98


>AF187068-1|AAF03888.1|  477|Tribolium castaneum proboscipedia
           ortholog protein.
          Length = 477

 Score = 21.8 bits (44), Expect = 4.1
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = -2

Query: 350 NSLPSKLG*GVNFGDGSYGASS 285
           N+ PS      NF + S GASS
Sbjct: 260 NNTPSATNNNTNFNNNSNGASS 281


>AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory receptor
           candidate 45 protein.
          Length = 379

 Score = 21.4 bits (43), Expect = 5.4
 Identities = 8/22 (36%), Positives = 13/22 (59%)
 Frame = +1

Query: 166 DWCSDTRERTARWYRKVEEQIV 231
           D C+   ++T  W  K++EQ V
Sbjct: 299 DACTIASKQTISWCYKLQEQFV 320


>AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory receptor
           candidate 8 protein.
          Length = 379

 Score = 21.4 bits (43), Expect = 5.4
 Identities = 8/22 (36%), Positives = 13/22 (59%)
 Frame = +1

Query: 166 DWCSDTRERTARWYRKVEEQIV 231
           D C+   ++T  W  K++EQ V
Sbjct: 299 DACTIASKQTISWCYKLQEQFV 320


>AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2
           protein.
          Length = 377

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 9/29 (31%), Positives = 13/29 (44%)
 Frame = +2

Query: 119 VDWNYPDQFSKQQALRTGALIPENALPVG 205
           +DW YP+   K+  +     I E   P G
Sbjct: 143 IDWEYPEAKDKENFITLLREIKEAFQPKG 171


>AF321227-2|AAK16422.1|  312|Tribolium castaneum Scr protein.
          Length = 312

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 13/40 (32%), Positives = 16/40 (40%)
 Frame = +1

Query: 427 TFGTYGYDNVTNVCPVHAQCILT*TLIKSSRKYVVTTQKT 546
           T G Y       + P H Q   T T   +S KY  +T  T
Sbjct: 69  TMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSST 108


>EF222296-1|ABN79656.2|  403|Tribolium castaneum arginine
           vasopressin receptor protein.
          Length = 403

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 8/18 (44%), Positives = 10/18 (55%)
 Frame = +3

Query: 438 LWIRQRYKCVPRTRSMYF 491
           LW R+RY    +   MYF
Sbjct: 60  LWTRRRYAGRKKLSRMYF 77


>AY052622-1|AAL15470.1|  290|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 290

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +1

Query: 277 YIPLDAPYEPSPKLTP 324
           Y+ L  P E  PK+TP
Sbjct: 194 YLELVIPPENGPKMTP 209


>AY052393-1|AAL15467.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +1

Query: 277 YIPLDAPYEPSPKLTP 324
           Y+ L  P E  PK+TP
Sbjct: 194 YLELVIPPENGPKMTP 209


>AY052391-1|AAL15465.1|  445|Tribolium castaneum kynurenine
           3-monooxygenase protein.
          Length = 445

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 8/16 (50%), Positives = 10/16 (62%)
 Frame = +1

Query: 277 YIPLDAPYEPSPKLTP 324
           Y+ L  P E  PK+TP
Sbjct: 194 YLELVIPPENGPKMTP 209


>AJ223614-1|CAA11490.1|  301|Tribolium castaneum orthodenticle-2
           protein protein.
          Length = 301

 Score = 20.6 bits (41), Expect = 9.5
 Identities = 8/16 (50%), Positives = 11/16 (68%)
 Frame = +3

Query: 216 GGTNCSSAFLGGARYP 263
           GG++ S A+L  A YP
Sbjct: 25  GGSSSSMAYLKSAPYP 40


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 139,230
Number of Sequences: 336
Number of extensions: 3149
Number of successful extensions: 14
Number of sequences better than 10.0: 14
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 13681771
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).