SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0030
         (704 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    26   0.26 
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    26   0.26 
AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory recept...    23   1.8  
AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory recept...    23   1.8  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   3.2  

>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
            variant 2 protein.
          Length = 1558

 Score = 26.2 bits (55), Expect = 0.26
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = -3

Query: 186  RTMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97
            +++F F + N +FV   FL+Q  K  I VKW
Sbjct: 1267 KSVFAFFMFNALFVLVVFLLQLNKDQIHVKW 1297


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B
            protein.
          Length = 1558

 Score = 26.2 bits (55), Expect = 0.26
 Identities = 13/31 (41%), Positives = 19/31 (61%), Gaps = 1/31 (3%)
 Frame = -3

Query: 186  RTMFIFHLLN-IFV*CKFLVQYAKSNIIVKW 97
            +++F F + N +FV   FL+Q  K  I VKW
Sbjct: 1267 KSVFAFFMFNALFVLVVFLLQLNKDQIHVKW 1297


>AM292370-1|CAL23182.1|  418|Tribolium castaneum gustatory receptor
           candidate 49 protein.
          Length = 418

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +3

Query: 177 TLFLFREIKLDYIHTLFFIIICTINYKYLC 266
           T++LF  I+     T   ++I T N  YLC
Sbjct: 296 TMYLFIHIRSRQEDTDTLVVIYTFNLFYLC 325


>AM292335-1|CAL23147.2|  374|Tribolium castaneum gustatory receptor
           candidate 14 protein.
          Length = 374

 Score = 23.4 bits (48), Expect = 1.8
 Identities = 11/30 (36%), Positives = 16/30 (53%)
 Frame = +3

Query: 177 TLFLFREIKLDYIHTLFFIIICTINYKYLC 266
           T++LF  I+     T   ++I T N  YLC
Sbjct: 252 TMYLFIHIRSRQEDTDTLVVIYTFNLFYLC 281


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 22.6 bits (46), Expect = 3.2
 Identities = 10/22 (45%), Positives = 12/22 (54%)
 Frame = +2

Query: 89  VINHLTIIFDFAYCTRNLH*TK 154
           +I   TI+F F YC  N   TK
Sbjct: 262 LIQFNTIVFSFCYCYYNSKMTK 283


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 162,244
Number of Sequences: 336
Number of extensions: 3798
Number of successful extensions: 5
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 5
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 5
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 18634795
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).