SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0021
         (393 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D pro...    23   1.1  
AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6 prot...    22   1.9  
DQ659249-1|ABG47447.1|  383|Tribolium castaneum chitinase 9 prot...    22   2.5  
AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2 prot...    22   2.5  
DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13 pro...    21   3.3  
AY337337-2|AAP94193.1|  491|Tribolium castaneum cytochrome P450 ...    21   4.4  
AF251548-1|AAF70178.1|  491|Tribolium castaneum cytochrome P450 ...    21   4.4  
AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5 prot...    21   5.8  
AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosin...    21   5.8  
AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone recepto...    21   5.8  
AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory recept...    20   7.6  

>EF125547-1|ABL73931.1|  255|Tribolium castaneum obstractor D
           protein.
          Length = 255

 Score = 23.0 bits (47), Expect = 1.1
 Identities = 11/20 (55%), Positives = 11/20 (55%)
 Frame = +3

Query: 234 PRL*RCPRAFCSRRRSTRTV 293
           PRL RCP      RRS R V
Sbjct: 181 PRLQRCPAMLVFDRRSLRCV 200


>AY873916-1|AAW67572.1|  377|Tribolium castaneum chitinase 6
          protein.
          Length = 377

 Score = 22.2 bits (45), Expect = 1.9
 Identities = 6/16 (37%), Positives = 10/16 (62%)
 Frame = +1

Query: 43 SQRMICHHISWAVREP 90
          S ++IC++ SW    P
Sbjct: 20 SDKIICYYASWGANRP 35



 Score = 21.4 bits (43), Expect = 3.3
 Identities = 12/42 (28%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
 Frame = +3

Query: 36  VRKSKNDLSSHF-LGGPGAGVACVTAITSAKSMNPLQCESSI 158
           ++K+   L + F LGG  AG A  TA+ +  +      +S++
Sbjct: 86  LKKTNPALKALFSLGGYAAGTATFTAVAADATKRATMAKSAL 127



 Score = 20.2 bits (40), Expect = 7.6
 Identities = 8/15 (53%), Positives = 9/15 (60%)
 Frame = +3

Query: 54  DLSSHFLGGPGAGVA 98
           D S H LG P +G A
Sbjct: 265 DASQHDLGSPSSGPA 279


>DQ659249-1|ABG47447.1|  383|Tribolium castaneum chitinase 9
          protein.
          Length = 383

 Score = 21.8 bits (44), Expect = 2.5
 Identities = 6/23 (26%), Positives = 13/23 (56%)
 Frame = +1

Query: 25 FVDLCVSQRMICHHISWAVREPE 93
          F+ L  +  ++C+  SW +  P+
Sbjct: 14 FLALASAGNVVCYFTSWTIYRPD 36


>AY873913-1|AAW67569.2|  377|Tribolium castaneum chitinase 2
          protein.
          Length = 377

 Score = 21.8 bits (44), Expect = 2.5
 Identities = 6/17 (35%), Positives = 12/17 (70%)
 Frame = +1

Query: 43 SQRMICHHISWAVREPE 93
          + ++IC+  SWA+  P+
Sbjct: 23 TDKVICYVASWAIYRPD 39


>DQ659252-1|ABG47450.1|  377|Tribolium castaneum chitinase 13
          protein.
          Length = 377

 Score = 21.4 bits (43), Expect = 3.3
 Identities = 5/16 (31%), Positives = 11/16 (68%)
 Frame = +1

Query: 43 SQRMICHHISWAVREP 90
          + ++IC++ SW  + P
Sbjct: 22 TDKVICYYASWGAQRP 37


>AY337337-2|AAP94193.1|  491|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 491

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 7/17 (41%), Positives = 10/17 (58%)
 Frame = +2

Query: 176 LMFYRVQHEPSLFPSLE 226
           L  Y + H P++FP  E
Sbjct: 389 LQIYDMHHNPNVFPDPE 405


>AF251548-1|AAF70178.1|  491|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q4 protein.
          Length = 491

 Score = 21.0 bits (42), Expect = 4.4
 Identities = 7/17 (41%), Positives = 10/17 (58%)
 Frame = +2

Query: 176 LMFYRVQHEPSLFPSLE 226
           L  Y + H P++FP  E
Sbjct: 389 LQIYDMHHNPNVFPDPE 405


>AY675073-1|AAV74190.1|  533|Tribolium castaneum chitinase 5
          protein.
          Length = 533

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 5/14 (35%), Positives = 10/14 (71%)
 Frame = +1

Query: 49 RMICHHISWAVREP 90
          R++C+  +WA+  P
Sbjct: 23 RIVCYFSNWAIYRP 36


>AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosine
           kinase Torso-likeprotein protein.
          Length = 803

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = -3

Query: 208 RWFVLDSIKHQLRY 167
           RW  L+S+ HQ RY
Sbjct: 659 RWMALESLTHQ-RY 671


>AM295015-1|CAL25730.1|  549|Tribolium castaneum ecdysone receptor
           (isoform A) protein.
          Length = 549

 Score = 20.6 bits (41), Expect = 5.8
 Identities = 7/11 (63%), Positives = 8/11 (72%)
 Frame = -3

Query: 106 VTQATPAPGPP 74
           V   TP+PGPP
Sbjct: 114 VPPLTPSPGPP 124


>AM292372-1|CAL23184.2|  771|Tribolium castaneum gustatory receptor
           candidate 51 protein.
          Length = 771

 Score = 20.2 bits (40), Expect = 7.6
 Identities = 10/29 (34%), Positives = 14/29 (48%)
 Frame = -3

Query: 217 WKQRWFVLDSIKHQLRYYDAMEDSHCKGF 131
           WK      D+I  +L+    +E S CK F
Sbjct: 501 WKMLVKSFDAIDSKLQTGGKVETSICKNF 529


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 73,689
Number of Sequences: 336
Number of extensions: 1269
Number of successful extensions: 15
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 15
length of database: 122,585
effective HSP length: 51
effective length of database: 105,449
effective search space used:  8330471
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 39 (20.8 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).