SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0018
         (502 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    25   0.38 
AF452568-1|AAL57830.1|  243|Tribolium castaneum homeodomain tran...    23   2.0  
AF321227-5|AAK16425.1|  292|Tribolium castaneum Zen2 protein.          23   2.0  
AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450 ...    22   2.7  
AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate neu...    21   4.7  
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    21   4.7  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   4.7  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   4.7  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   4.7  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   4.7  

>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 25.0 bits (52), Expect = 0.38
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +2

Query: 308 IVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 403
           +VT+W + E+I++     +L V     PV+LT
Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILT 189


>AF452568-1|AAL57830.1|  243|Tribolium castaneum homeodomain
           transcription factor Zen2 protein.
          Length = 243

 Score = 22.6 bits (46), Expect = 2.0
 Identities = 9/19 (47%), Positives = 10/19 (52%)
 Frame = +1

Query: 427 PTEEKMTPDSWFENNSTRP 483
           P E  M+P S   NNS  P
Sbjct: 155 PNEASMSPQSTSSNNSASP 173


>AF321227-5|AAK16425.1|  292|Tribolium castaneum Zen2 protein.
          Length = 292

 Score = 22.6 bits (46), Expect = 2.0
 Identities = 9/19 (47%), Positives = 10/19 (52%)
 Frame = +1

Query: 427 PTEEKMTPDSWFENNSTRP 483
           P E  M+P S   NNS  P
Sbjct: 175 PNEASMSPQSTSSNNSASP 193


>AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 127

 Score = 22.2 bits (45), Expect = 2.7
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +1

Query: 277 PDPQIPHRTRNRH 315
           PD  +P RT NRH
Sbjct: 110 PDNFLPERTANRH 122


>AY695257-1|AAW21974.1|  224|Tribolium castaneum intermediate
           neuroblasts defectiveprotein protein.
          Length = 224

 Score = 21.4 bits (43), Expect = 4.7
 Identities = 7/13 (53%), Positives = 9/13 (69%)
 Frame = +1

Query: 412 PQPQGPTEEKMTP 450
           P P  P EE++TP
Sbjct: 99  PTPSPPPEERLTP 111


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 21.4 bits (43), Expect = 4.7
 Identities = 9/21 (42%), Positives = 10/21 (47%)
 Frame = -3

Query: 392 RGVPRGRHAAHCRRYDAKSSP 330
           RG P    AA C +   KS P
Sbjct: 33  RGTPLAMLAAQCNKLSNKSPP 53


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 4.7
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 346 MPNLLHVIPVSDDSVFD 296
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 4.7
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 346 MPNLLHVIPVSDDSVFD 296
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 4.7
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 346 MPNLLHVIPVSDDSVFD 296
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 4.7
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 346 MPNLLHVIPVSDDSVFD 296
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 129,690
Number of Sequences: 336
Number of extensions: 3136
Number of successful extensions: 11
Number of sequences better than 10.0: 10
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 11839801
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 40 (21.2 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).