SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0015
         (657 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory recept...    24   1.3  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   5.1  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   5.1  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   5.1  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   5.1  
AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription fa...    21   6.7  
EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4 prot...    21   8.9  
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    21   8.9  
AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory recept...    21   8.9  

>AM292344-1|CAL23156.1|  291|Tribolium castaneum gustatory receptor
           candidate 23 protein.
          Length = 291

 Score = 23.8 bits (49), Expect = 1.3
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = -3

Query: 190 SYAYSVFRKKKSVVCKVGLLTIVERDNVIRKY*W 89
           S  YS+ R K+ +     LLT +  +N  RKY W
Sbjct: 24  SVIYSLLRVKRMMRSWYYLLTNLTYNNTNRKYYW 57


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -1

Query: 468 RLQFLFLENESCFFKSGK 415
           +L  LF  +  CFFKS K
Sbjct: 143 QLGSLFRSSRMCFFKSSK 160


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -1

Query: 468 RLQFLFLENESCFFKSGK 415
           +L  LF  +  CFFKS K
Sbjct: 143 QLGSLFRSSRMCFFKSSK 160


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -1

Query: 468 RLQFLFLENESCFFKSGK 415
           +L  LF  +  CFFKS K
Sbjct: 143 QLGSLFRSSRMCFFKSSK 160


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.1
 Identities = 9/18 (50%), Positives = 11/18 (61%)
 Frame = -1

Query: 468 RLQFLFLENESCFFKSGK 415
           +L  LF  +  CFFKS K
Sbjct: 143 QLGSLFRSSRMCFFKSSK 160


>AJ415419-1|CAC94468.1|  441|Tribolium castaneum transcription
           factor protein.
          Length = 441

 Score = 21.4 bits (43), Expect = 6.7
 Identities = 9/22 (40%), Positives = 12/22 (54%)
 Frame = -1

Query: 231 FPIFYTIRANIDSKAMHIQCLE 166
           FP+     A +D KAM+   LE
Sbjct: 58  FPVVKVTAAGLDPKAMYTVLLE 79


>EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4
           protein.
          Length = 475

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 6/18 (33%), Positives = 12/18 (66%)
 Frame = -2

Query: 443 MKAVFLRAVKHIILRWSF 390
           ++AVF+++V   +  W F
Sbjct: 117 LRAVFIKSVVEFVKTWGF 134


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
           candidate 46 protein.
          Length = 1451

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/40 (17%), Positives = 21/40 (52%)
 Frame = +1

Query: 307 TSSSIINPSIVGSSYVLISLHQFVFMYEKLHLSIICFTAL 426
           T++ +    I  +    ++L    F+++ +HL  +C++ +
Sbjct: 266 TAAELQASQIKWTRIAYMALASVPFIFDSIHLCDVCYSTI 305


>AM292324-1|CAL23136.1|  398|Tribolium castaneum gustatory receptor
           candidate 3 protein.
          Length = 398

 Score = 21.0 bits (42), Expect = 8.9
 Identities = 7/40 (17%), Positives = 21/40 (52%)
 Frame = +1

Query: 307 TSSSIINPSIVGSSYVLISLHQFVFMYEKLHLSIICFTAL 426
           T++ +    I  +    ++L    F+++ +HL  +C++ +
Sbjct: 284 TAAELQASQIKWTRIAYMALASVPFIFDSIHLCDVCYSTI 323


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 158,580
Number of Sequences: 336
Number of extensions: 3467
Number of successful extensions: 12
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16969115
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).