SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0014
         (593 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4 prot...    27   0.12 
U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.    22   3.4  
AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.     22   4.5  
DQ138190-1|ABA03054.1|  135|Tribolium castaneum bursicon-like pr...    21   5.9  

>EF125543-1|ABL73927.1|  475|Tribolium castaneum chitinase 4
           protein.
          Length = 475

 Score = 27.1 bits (57), Expect = 0.12
 Identities = 9/26 (34%), Positives = 17/26 (65%)
 Frame = +2

Query: 320 TSFICT*SDSVRETDGCGLQWYCVLH 397
           T+ +CT +  VR+ D C + +YC+ +
Sbjct: 418 TTTLCTKAGYVRDPDDCSIFYYCLAY 443


>U14732-1|AAC46491.1|  322|Tribolium castaneum fushi-tarazu protein.
          Length = 322

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 9/21 (42%), Positives = 13/21 (61%)
 Frame = -3

Query: 525 CSKHLVHARGVRGLRTKLKEA 463
           C+K L   R +RG R +L+ A
Sbjct: 273 CAKPLTQIRNIRGPRKRLRFA 293


>AJ307577-1|CAC84070.1|  301|Tribolium castaneum dachshund protein.
          Length = 301

 Score = 21.8 bits (44), Expect = 4.5
 Identities = 14/34 (41%), Positives = 16/34 (47%)
 Frame = -1

Query: 110 H*ERTRGEMNYGCSL*PARTFATDTEPRDMGPRN 9
           H ER R E    C   P R    D + RD+ PRN
Sbjct: 176 HLERLREER---CD--PDRPLPLDQKARDLSPRN 204


>DQ138190-1|ABA03054.1|  135|Tribolium castaneum bursicon-like
           protein protein.
          Length = 135

 Score = 21.4 bits (43), Expect = 5.9
 Identities = 11/35 (31%), Positives = 18/35 (51%)
 Frame = +3

Query: 351 FEKLTDVDFSGTAYYTVRNLSLYECQGLVPERNLI 455
           F+K+       T  Y+V  +S   C+ L+ + NLI
Sbjct: 2   FDKIILCLVYATCVYSVSEISEETCETLMSDINLI 36


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 135,785
Number of Sequences: 336
Number of extensions: 2642
Number of successful extensions: 4
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14935063
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).