SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0013
         (573 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    24   0.80 
DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome ad...    23   2.4  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   3.2  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   3.2  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   3.2  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   3.2  
EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetyla...    21   5.6  
EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-toler...    21   7.5  

>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 24.2 bits (50), Expect = 0.80
 Identities = 10/35 (28%), Positives = 19/35 (54%)
 Frame = +3

Query: 327 GWQSWAA*LLHQLSRGGARYPIRPIVSRITIHWPS 431
           GW  W+   +++L+R  A   +    +R T++W S
Sbjct: 569 GWFFWSLLRIYELARKAAFAHLNSNEARATLNWVS 603


>DQ157471-1|AAZ85125.1| 1639|Tribolium castaneum Down Syndrome
           adhesion molecule splicevariant 3.12.3.1 protein.
          Length = 1639

 Score = 22.6 bits (46), Expect = 2.4
 Identities = 8/11 (72%), Positives = 10/11 (90%)
 Frame = -3

Query: 202 GHAVGDIPGVR 170
           G AVGD+PG+R
Sbjct: 62  GTAVGDVPGLR 72


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.2
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -3

Query: 517 YYAAAKGECACKAIKLGNARVFPV 446
           Y+A   G+ ACK +  G +  FPV
Sbjct: 389 YFAYIFGKFACKIMIQGFSYAFPV 412


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.2
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -3

Query: 517 YYAAAKGECACKAIKLGNARVFPV 446
           Y+A   G+ ACK +  G +  FPV
Sbjct: 389 YFAYIFGKFACKIMIQGFSYAFPV 412


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.2
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -3

Query: 517 YYAAAKGECACKAIKLGNARVFPV 446
           Y+A   G+ ACK +  G +  FPV
Sbjct: 389 YFAYIFGKFACKIMIQGFSYAFPV 412


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 22.2 bits (45), Expect = 3.2
 Identities = 10/24 (41%), Positives = 14/24 (58%)
 Frame = -3

Query: 517 YYAAAKGECACKAIKLGNARVFPV 446
           Y+A   G+ ACK +  G +  FPV
Sbjct: 389 YFAYIFGKFACKIMIQGFSYAFPV 412


>EU019711-1|ABU25223.1|  534|Tribolium castaneum chitin deacetylase
           1 protein.
          Length = 534

 Score = 21.4 bits (43), Expect = 5.6
 Identities = 8/19 (42%), Positives = 9/19 (47%)
 Frame = +1

Query: 88  CTPMILVAPFSLCRERGET 144
           C P + V P   C E G T
Sbjct: 163 CDPAVCVLPDCFCSEDGTT 181


>EF468474-1|ABR25244.1|  516|Tribolium castaneum methoprene-tolerant
           protein.
          Length = 516

 Score = 21.0 bits (42), Expect = 7.5
 Identities = 8/32 (25%), Positives = 16/32 (50%)
 Frame = -2

Query: 341 PTLPSANASVYSSLRTERK*PHSSPVTVAKPH 246
           P       ++Y+S + +R  P  SP++   P+
Sbjct: 457 PPSTELGTNIYTSSKRQRTSPQLSPMSSLPPY 488


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 142,655
Number of Sequences: 336
Number of extensions: 3219
Number of successful extensions: 8
Number of sequences better than 10.0: 8
Number of HSP's better than 10.0 without gapping: 8
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 8
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 14203976
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).