SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0008
         (564 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory recept...    31   0.009
AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept...    27   0.15 
EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggeri...    23   1.8  
EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggeri...    23   1.8  
AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory recept...    23   2.4  
AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory recept...    23   2.4  
AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory recept...    23   2.4  
AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory recept...    23   2.4  
AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory recept...    22   4.2  
U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.     21   5.5  
U81038-1|AAB39355.1|  412|Tribolium castaneum transcription fact...    21   5.5  
AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory recept...    21   5.5  
AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory recept...    21   5.5  
AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.           21   5.5  
AF243042-1|AAF68438.1|  126|Tribolium castaneum mutant transcrip...    21   5.5  
AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory recept...    21   9.6  

>AM292340-1|CAL23152.1|  355|Tribolium castaneum gustatory receptor
           candidate 19 protein.
          Length = 355

 Score = 30.7 bits (66), Expect = 0.009
 Identities = 21/62 (33%), Positives = 28/62 (45%), Gaps = 1/62 (1%)
 Frame = -1

Query: 201 IDISRLRLSRFPTFNPFHLYFILKVFHS-YCCNFIKKTCIFYFVSCFIYIFSVV*FTSVC 25
           +D   L L   P    F+  FI+   H  + C  I   CI+YF   FI +F+V     VC
Sbjct: 199 LDYFTLHLLFLPCIYYFYSAFIIFTIHLLFYCVLIILLCIYYFYYAFI-LFTVHLLLLVC 257

Query: 24  NY 19
            Y
Sbjct: 258 IY 259



 Score = 30.7 bits (66), Expect = 0.009
 Identities = 13/30 (43%), Positives = 18/30 (60%)
 Frame = -1

Query: 150 HLYFILKVFHSYCCNFIKKTCIFYFVSCFI 61
           HL F+L +++ YC   I   CI+YF   FI
Sbjct: 278 HLLFLLCIYYFYCALIIL-LCIYYFCRAFI 306



 Score = 25.8 bits (54), Expect = 0.26
 Identities = 12/31 (38%), Positives = 17/31 (54%)
 Frame = -1

Query: 150 HLYFILKVFHSYCCNFIKKTCIFYFVSCFIY 58
           HL F+L ++H +C  FI  T    F   FI+
Sbjct: 159 HLLFLLCIYHFFCA-FIIFTMHLLFCCAFIF 188



 Score = 25.0 bits (52), Expect = 0.45
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = -1

Query: 147 LYFILKVFHSYCCNFIKKTCIFYFVSCFIYIF 52
           L+F+L +++ YC  FI  T    F+ C  + F
Sbjct: 140 LFFLLCIYYFYCA-FIIFTVHLLFLLCIYHFF 170



 Score = 24.2 bits (50), Expect = 0.78
 Identities = 9/32 (28%), Positives = 15/32 (46%)
 Frame = -1

Query: 147 LYFILKVFHSYCCNFIKKTCIFYFVSCFIYIF 52
           +Y+   +   +CC FI  T    F+ C  Y +
Sbjct: 258 IYYFYYMHLLFCCAFIIFTMHLLFLLCIYYFY 289



 Score = 21.4 bits (43), Expect = 5.5
 Identities = 8/37 (21%), Positives = 17/37 (45%)
 Frame = -1

Query: 147 LYFILKVFHSYCCNFIKKTCIFYFVSCFIYIFSVV*F 37
           +Y+    F  +  + +   CI+YFV    ++  +  F
Sbjct: 113 VYYFYYAFIIFTVHLLFLLCIYYFVVPLFFLLCIYYF 149



 Score = 21.4 bits (43), Expect = 5.5
 Identities = 10/27 (37%), Positives = 15/27 (55%), Gaps = 5/27 (18%)
 Frame = -3

Query: 91  MHILFCVVF-----YIYFFCSVIYFSL 26
           MH+LFC  F     ++ F   + YF+L
Sbjct: 178 MHLLFCCAFIFFNMHLLFLLCLDYFTL 204



 Score = 21.0 bits (42), Expect = 7.3
 Identities = 7/19 (36%), Positives = 13/19 (68%)
 Frame = -3

Query: 82  LFCVVFYIYFFCSVIYFSL 26
           LF ++   YF+C+ I F++
Sbjct: 140 LFFLLCIYYFYCAFIIFTV 158


>AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor
            candidate 46 protein.
          Length = 1451

 Score = 26.6 bits (56), Expect = 0.15
 Identities = 11/30 (36%), Positives = 19/30 (63%)
 Frame = -3

Query: 223  FGRLIVGNRHLKTSLESISDI*SVPLVFYF 134
            FG+L   + HL   ++S ++I  VPL+ +F
Sbjct: 1301 FGKLCSLHHHLSKLIKSFNEIYGVPLLLFF 1330


>EF222294-1|ABN79654.1|  451|Tribolium castaneum ecdysis triggering
           hormone receptorisoform B protein.
          Length = 451

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 8/31 (25%), Positives = 17/31 (54%)
 Frame = -3

Query: 274 IIFCYILLCTGTSGLTIFGRLIVGNRHLKTS 182
           ++FC I++C G  G  +   +I   + ++ S
Sbjct: 72  MVFCIIIMCLGVIGNVMVPIVIFKTKDMRNS 102


>EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggering
           hormone receptorisoform A protein.
          Length = 434

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 8/31 (25%), Positives = 17/31 (54%)
 Frame = -3

Query: 274 IIFCYILLCTGTSGLTIFGRLIVGNRHLKTS 182
           ++FC I++C G  G  +   +I   + ++ S
Sbjct: 72  MVFCIIIMCLGVIGNVMVPIVIFKTKDMRNS 102


>AM292382-1|CAL23194.2|  670|Tribolium castaneum gustatory receptor
           candidate 61 protein.
          Length = 670

 Score = 22.6 bits (46), Expect = 2.4
 Identities = 7/24 (29%), Positives = 15/24 (62%)
 Frame = -3

Query: 100 KKNMHILFCVVFYIYFFCSVIYFS 29
           K N +  F ++FY+  F  ++Y++
Sbjct: 317 KTNKYCNFIILFYLSVFVILVYYA 340


>AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory receptor
           candidate 47 protein.
          Length = 387

 Score = 22.6 bits (46), Expect = 2.4
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = +1

Query: 259 YNKI*YTHFTLYMNYNNSYGYINC 330
           Y+   Y H    +N N +  YINC
Sbjct: 157 YHTTAYLHIITMINMNCALWYINC 180


>AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory receptor
           candidate 26 protein.
          Length = 387

 Score = 22.6 bits (46), Expect = 2.4
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = +1

Query: 259 YNKI*YTHFTLYMNYNNSYGYINC 330
           Y+   Y H    +N N +  YINC
Sbjct: 157 YHTTAYLHIITMINMNCALWYINC 180


>AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory receptor
           candidate 6 protein.
          Length = 387

 Score = 22.6 bits (46), Expect = 2.4
 Identities = 9/24 (37%), Positives = 12/24 (50%)
 Frame = +1

Query: 259 YNKI*YTHFTLYMNYNNSYGYINC 330
           Y+   Y H    +N N +  YINC
Sbjct: 157 YHTTAYLHIITMINMNCALWYINC 180


>AM292336-1|CAL23148.2|  455|Tribolium castaneum gustatory receptor
           candidate 15 protein.
          Length = 455

 Score = 21.8 bits (44), Expect = 4.2
 Identities = 6/17 (35%), Positives = 12/17 (70%)
 Frame = -3

Query: 88  HILFCVVFYIYFFCSVI 38
           H+LF V+F +  +C ++
Sbjct: 122 HLLFLVIFVLNIWCWIV 138


>U81040-1|AAB39356.1|  283|Tribolium castaneum TC Deformed protein.
          Length = 283

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 5/21 (23%)
 Frame = +1

Query: 292 YMNYN-----NSYGYINCYNP 339
           + NYN     N YGY N Y+P
Sbjct: 67  HQNYNSNVLSNGYGYGNYYHP 87


>U81038-1|AAB39355.1|  412|Tribolium castaneum transcription factor
           Deformed protein.
          Length = 412

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 5/21 (23%)
 Frame = +1

Query: 292 YMNYN-----NSYGYINCYNP 339
           + NYN     N YGY N Y+P
Sbjct: 67  HQNYNSNVLSNGYGYGNYYHP 87


>AM292366-1|CAL23178.2|  379|Tribolium castaneum gustatory receptor
           candidate 45 protein.
          Length = 379

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 9/32 (28%), Positives = 17/32 (53%)
 Frame = -1

Query: 138 ILKVFHSYCCNFIKKTCIFYFVSCFIYIFSVV 43
           +LK   S+  N ++   + +FV   +YI + V
Sbjct: 120 VLKNRDSHETNLLRNVSVQFFVYVILYILATV 151


>AM292329-1|CAL23141.2|  379|Tribolium castaneum gustatory receptor
           candidate 8 protein.
          Length = 379

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 9/32 (28%), Positives = 17/32 (53%)
 Frame = -1

Query: 138 ILKVFHSYCCNFIKKTCIFYFVSCFIYIFSVV 43
           +LK   S+  N ++   + +FV   +YI + V
Sbjct: 120 VLKNRDSHETNLLRNVSVQFFVYVILYILATV 151


>AF321227-3|AAK16423.1|  412|Tribolium castaneum Dfd protein.
          Length = 412

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 5/21 (23%)
 Frame = +1

Query: 292 YMNYN-----NSYGYINCYNP 339
           + NYN     N YGY N Y+P
Sbjct: 67  HQNYNSNVLSNGYGYGNYYHP 87


>AF243042-1|AAF68438.1|  126|Tribolium castaneum mutant
           transcription factor TcDfd1 protein.
          Length = 126

 Score = 21.4 bits (43), Expect = 5.5
 Identities = 10/21 (47%), Positives = 12/21 (57%), Gaps = 5/21 (23%)
 Frame = +1

Query: 292 YMNYN-----NSYGYINCYNP 339
           + NYN     N YGY N Y+P
Sbjct: 67  HQNYNSNVLSNGYGYGNYYHP 87


>AM292322-1|CAL23134.1|  373|Tribolium castaneum gustatory
          receptor candidate 1 protein.
          Length = 373

 Score = 20.6 bits (41), Expect = 9.6
 Identities = 7/18 (38%), Positives = 10/18 (55%)
 Frame = -3

Query: 79 FCVVFYIYFFCSVIYFSL 26
          FC       +CSV +F+L
Sbjct: 43 FCTFVAALVYCSVTFFAL 60


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 137,711
Number of Sequences: 336
Number of extensions: 3169
Number of successful extensions: 27
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 16
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 24
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 13890653
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).