SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0007
         (555 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc gr...    25   0.33 
AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     25   0.44 
AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory recept...    23   1.4  
AM292346-1|CAL23158.2|  314|Tribolium castaneum gustatory recept...    23   1.4  
AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein ...    23   1.4  
AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450 ...    23   1.8  
AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450 ...    23   1.8  
L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protei...    21   7.2  
AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory recept...    21   7.2  

>DQ659253-1|ABG47451.1|  439|Tribolium castaneum imaginal disc
           growth factor 2 protein.
          Length = 439

 Score = 25.4 bits (53), Expect = 0.33
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 4/75 (5%)
 Frame = +3

Query: 18  YCFTAVIGRAVIPTRTYGCTRCSSKF**FQVFKLNSGCITCKDIQNKY----VLLNYVNN 185
           YC   + G A I   TY  T  + +   F V K N   +T  D++ ++    VLL+   N
Sbjct: 54  YCTHLIYGYAAIDEETYKLTPLNEQ---FDVIKDNYRKVT--DLKKRFPKLKVLLSVGGN 108

Query: 186 KEATSL*QEKTSKIR 230
            + +   +EK  K R
Sbjct: 109 ADVSGQDEEKNIKYR 123


>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 25.0 bits (52), Expect = 0.44
 Identities = 14/47 (29%), Positives = 23/47 (48%)
 Frame = +3

Query: 132 ITCKDIQNKYVLLNYVNNKEATSL*QEKTSKIRGSYFMNE*HLSNCQ 272
           +T   +QN    LNY++ K  +     +  +I    F NE  +SNC+
Sbjct: 453 VTNTTLQNLTPQLNYISMKLQSFPLLSQRHQIDAKMFCNESSVSNCE 499


>AM292380-1|CAL23192.2|  489|Tribolium castaneum gustatory receptor
           candidate 59 protein.
          Length = 489

 Score = 23.4 bits (48), Expect = 1.4
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = -2

Query: 476 VFLNSLPFYQNPLEILKTCRVTHMTFLSQK 387
           +FL  L    N LEIL T  V  +T L  K
Sbjct: 279 IFLPLLCILTNTLEILITVTVCELTILEYK 308


>AM292346-1|CAL23158.2|  314|Tribolium castaneum gustatory receptor
           candidate 25 protein.
          Length = 314

 Score = 23.4 bits (48), Expect = 1.4
 Identities = 13/30 (43%), Positives = 15/30 (50%)
 Frame = -2

Query: 476 VFLNSLPFYQNPLEILKTCRVTHMTFLSQK 387
           +FL  L    N LEIL T  V  +T L  K
Sbjct: 104 IFLPLLCILTNTLEILITVTVCELTILEYK 133


>AF236856-1|AAG17563.2|  370|Tribolium castaneum Kruppel protein
           protein.
          Length = 370

 Score = 23.4 bits (48), Expect = 1.4
 Identities = 8/12 (66%), Positives = 8/12 (66%)
 Frame = +3

Query: 60  RTYGCTRCSSKF 95
           R YGC  CS KF
Sbjct: 217 RPYGCEHCSMKF 228


>AY337337-1|AAP94192.1|  505|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 505

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = -3

Query: 229 LIFEVFSCYKDVASLLFT*FNKTYL 155
           L+F +F CYK +   +++  + +YL
Sbjct: 15  LLFYLFYCYKTIKQHIYSLISLSYL 39


>AF254755-1|AAF70496.1|  505|Tribolium castaneum cytochrome P450
           monooxigenase CYP4Q7 protein.
          Length = 505

 Score = 23.0 bits (47), Expect = 1.8
 Identities = 8/25 (32%), Positives = 16/25 (64%)
 Frame = -3

Query: 229 LIFEVFSCYKDVASLLFT*FNKTYL 155
           L+F +F CYK +   +++  + +YL
Sbjct: 15  LLFYLFYCYKTIKQHIYSLISLSYL 39


>L01616-1|AAA30096.1|   74|Tribolium castaneum zinc finger protein
          protein.
          Length = 74

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = +3

Query: 60 RTYGCTRCSSK 92
          R YGC  CS K
Sbjct: 64 RPYGCEHCSMK 74


>AM292337-1|CAL23149.2|  452|Tribolium castaneum gustatory receptor
           candidate 16 protein.
          Length = 452

 Score = 21.0 bits (42), Expect = 7.2
 Identities = 9/24 (37%), Positives = 13/24 (54%)
 Frame = -2

Query: 368 LKVHKQYLKTSVLHKTLPYQPSFY 297
           +K+HK Y+   +L K L   P  Y
Sbjct: 4   VKLHKHYVPIILLSKILGIAPISY 27


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 127,418
Number of Sequences: 336
Number of extensions: 2554
Number of successful extensions: 9
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 53
effective length of database: 104,777
effective search space used: 13725787
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).