SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0006
         (600 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    23   2.0  
AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc fin...    23   2.6  
DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory pro...    22   3.4  
DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory pro...    22   3.4  
AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450 ...    22   3.4  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   6.0  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   6.0  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   6.0  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   6.0  

>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 23.0 bits (47), Expect = 2.0
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -2

Query: 182 GTRREEHHLLRNRP 141
           G R+  HHL++N+P
Sbjct: 82  GVRKVLHHLIKNKP 95


>AY316682-1|AAQ83696.1|  456|Tribolium castaneum Sp-like zinc finger
           protein protein.
          Length = 456

 Score = 22.6 bits (46), Expect = 2.6
 Identities = 10/34 (29%), Positives = 17/34 (50%)
 Frame = +1

Query: 376 APRGTPSPAH*GSPQPQGHREKDDPYHVSKTFYT 477
           +P+G PSP+   S  P       +P + S++  T
Sbjct: 70  SPQGAPSPSSTPSSLPTQRTSTSNPTYSSRSVMT 103


>DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory
           protein 16 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -2

Query: 182 GTRREEHHLLRNRP 141
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory
           protein 9 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -2

Query: 182 GTRREEHHLLRNRP 141
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 127

 Score = 22.2 bits (45), Expect = 3.4
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +3

Query: 279 PDPQIPHRTRNRH 317
           PD  +P RT NRH
Sbjct: 110 PDNFLPERTANRH 122


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 348 MPNLLHVIPVSDDSVFD 298
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 348 MPNLLHVIPVSDDSVFD 298
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 348 MPNLLHVIPVSDDSVFD 298
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.0
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 348 MPNLLHVIPVSDDSVFD 298
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 167,280
Number of Sequences: 336
Number of extensions: 4342
Number of successful extensions: 12
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 12
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15143945
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).