SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0005
         (609 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggeri...    23   2.7  
AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head orthol...    23   2.7  
DQ855492-1|ABH88179.1|  251|Tribolium castaneum chemosensory pro...    22   3.5  

>EF222293-1|ABN79653.1|  434|Tribolium castaneum ecdysis triggering
           hormone receptorisoform A protein.
          Length = 434

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 12/24 (50%), Positives = 13/24 (54%)
 Frame = -2

Query: 317 SNRSTLLLHGRNGQGSTRADSKRS 246
           SNR       RNG  ST A+S RS
Sbjct: 368 SNRKFYFKRARNGTFSTTANSCRS 391


>AF217810-1|AAF71998.1|  431|Tribolium castaneum fork head
           orthologue protein.
          Length = 431

 Score = 22.6 bits (46), Expect = 2.7
 Identities = 10/34 (29%), Positives = 15/34 (44%)
 Frame = +3

Query: 108 NAKHQIQKIQLSFCKELSLPDNHQVDKDHLETNH 209
           N  H+     ++ C  LSL  +HQ    H   +H
Sbjct: 321 NMSHEELSAMVNRCHPLSLSSDHQAMLHHNPMSH 354


>DQ855492-1|ABH88179.1|  251|Tribolium castaneum chemosensory
           protein 6 protein.
          Length = 251

 Score = 22.2 bits (45), Expect = 3.5
 Identities = 7/11 (63%), Positives = 7/11 (63%)
 Frame = -1

Query: 204 LFPNGPCPPDG 172
           L   GPCPP G
Sbjct: 47  LLSKGPCPPQG 57


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,687
Number of Sequences: 336
Number of extensions: 3321
Number of successful extensions: 7
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 7
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 7
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 15457268
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).