SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ce--0004
         (637 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory recept...    25   0.53 
AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax pr...    24   0.92 
DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory pro...    23   2.1  
AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esteras...    23   2.8  
AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esteras...    23   2.8  
AJ850294-1|CAH64514.1|  539|Tribolium castaneum putative esteras...    23   2.8  
AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esteras...    23   2.8  
AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esteras...    23   2.8  
DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory pro...    22   3.7  
DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory pro...    22   3.7  
AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450 ...    22   3.7  
AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosin...    22   4.9  
AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    21   6.5  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    21   6.5  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    21   6.5  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    21   6.5  
AF265297-1|AAG17640.1|  125|Tribolium castaneum putative cytochr...    21   8.6  

>AM292359-1|CAL23171.2|  436|Tribolium castaneum gustatory receptor
           candidate 38 protein.
          Length = 436

 Score = 25.0 bits (52), Expect = 0.53
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = +2

Query: 290 IVTNWDDMEKIWHHTFYNELRVAPEEHPVLLT 385
           +VT+W + E+I++     +L V     PV+LT
Sbjct: 158 VVTDWVNFERIYYKLTKKKLSVFFGNKPVILT 189


>AY074761-1|AAL71874.1|  314|Tribolium castaneum ultrabithorax
           protein.
          Length = 314

 Score = 24.2 bits (50), Expect = 0.92
 Identities = 12/37 (32%), Positives = 19/37 (51%)
 Frame = +3

Query: 468 RLAFKPVLLAVRLPSVPPGIRAGTSREPVFFHNPCPI 578
           R+ +  V L    P+  PG  AG +   + ++NPC I
Sbjct: 149 RVGYGSVGLVGGDPASSPGAAAGRTGNSLSWNNPCSI 185


>DQ855500-1|ABH88187.1|  126|Tribolium castaneum chemosensory
           protein 14 protein.
          Length = 126

 Score = 23.0 bits (47), Expect = 2.1
 Identities = 7/14 (50%), Positives = 11/14 (78%)
 Frame = -2

Query: 162 GTRREEHHLLRNRP 121
           G R+  HHL++N+P
Sbjct: 82  GVRKVLHHLIKNKP 95


>AJ850297-1|CAH64517.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +3

Query: 579 LPKGIPHFSPTPISLAVFG 635
           + K I HF  TP S+ +FG
Sbjct: 179 IKKYIQHFGGTPDSITLFG 197


>AJ850295-1|CAH64515.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +3

Query: 579 LPKGIPHFSPTPISLAVFG 635
           + K I HF  TP S+ +FG
Sbjct: 179 IKKYIQHFGGTPDSITLFG 197


>AJ850294-1|CAH64514.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +3

Query: 579 LPKGIPHFSPTPISLAVFG 635
           + K I HF  TP S+ +FG
Sbjct: 179 IKKYIQHFGGTPDSITLFG 197


>AJ850293-1|CAH64513.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +3

Query: 579 LPKGIPHFSPTPISLAVFG 635
           + K I HF  TP S+ +FG
Sbjct: 179 IKKYIQHFGGTPDSITLFG 197


>AJ850292-1|CAH64512.1|  539|Tribolium castaneum putative esterase
           protein.
          Length = 539

 Score = 22.6 bits (46), Expect = 2.8
 Identities = 9/19 (47%), Positives = 12/19 (63%)
 Frame = +3

Query: 579 LPKGIPHFSPTPISLAVFG 635
           + K I HF  TP S+ +FG
Sbjct: 179 IKKYIQHFGGTPDSITLFG 197


>DQ855502-1|ABH88189.1|  126|Tribolium castaneum chemosensory
           protein 16 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -2

Query: 162 GTRREEHHLLRNRP 121
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>DQ855495-1|ABH88182.1|  126|Tribolium castaneum chemosensory
           protein 9 protein.
          Length = 126

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 7/14 (50%), Positives = 10/14 (71%)
 Frame = -2

Query: 162 GTRREEHHLLRNRP 121
           G R+  HHL+ N+P
Sbjct: 82  GVRKVIHHLIENKP 95


>AF263514-1|AAF74206.1|  127|Tribolium castaneum cytochrome P450
           monooxygenase protein.
          Length = 127

 Score = 22.2 bits (45), Expect = 3.7
 Identities = 8/13 (61%), Positives = 9/13 (69%)
 Frame = +1

Query: 259 PDPQIPHRTRNRH 297
           PD  +P RT NRH
Sbjct: 110 PDNFLPERTANRH 122


>AY618898-1|AAU87291.1|  803|Tribolium castaneum receptor tyrosine
           kinase Torso-likeprotein protein.
          Length = 803

 Score = 21.8 bits (44), Expect = 4.9
 Identities = 6/18 (33%), Positives = 10/18 (55%)
 Frame = +2

Query: 482 ARASRCTPSVRTTRYSCW 535
           AR + C+P +     +CW
Sbjct: 714 ARPANCSPDLYAVMLNCW 731


>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 328 MPNLLHVIPVSDDSVFD 278
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 328 MPNLLHVIPVSDDSVFD 278
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 328 MPNLLHVIPVSDDSVFD 278
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.4 bits (43), Expect = 6.5
 Identities = 6/17 (35%), Positives = 11/17 (64%)
 Frame = -1

Query: 328 MPNLLHVIPVSDDSVFD 278
           +P++  +IP  DD+  D
Sbjct: 355 LPDISEIIPTGDDTTMD 371


>AF265297-1|AAG17640.1|  125|Tribolium castaneum putative cytochrome
           P450 monooxigenase protein.
          Length = 125

 Score = 21.0 bits (42), Expect = 8.6
 Identities = 6/13 (46%), Positives = 9/13 (69%)
 Frame = +1

Query: 232 EMRHRAKEYPDPQ 270
           +M H  + YPDP+
Sbjct: 92  DMHHNPQVYPDPE 104


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 176,475
Number of Sequences: 336
Number of extensions: 4478
Number of successful extensions: 20
Number of sequences better than 10.0: 17
Number of HSP's better than 10.0 without gapping: 20
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 20
length of database: 122,585
effective HSP length: 54
effective length of database: 104,441
effective search space used: 16397237
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).