SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30060
         (824 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces...    28   1.8  
SPAC20G8.05c |cdc15||cell division control protein Cdc15|Schizos...    27   2.4  
SPBC354.10 |||RNAPII degradation factor |Schizosaccharomyces pom...    27   4.3  
SPCC188.07 |ccq1||telomere maintenence protein|Schizosaccharomyc...    27   4.3  
SPCC24B10.19c |||sequence orphan|Schizosaccharomyces pombe|chr 3...    26   7.5  
SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr...    25   9.9  
SPAC15A10.02 |taf12||transcription factor TFIID complex subunit ...    25   9.9  
SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch...    25   9.9  
SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    25   9.9  

>SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 3699

 Score = 27.9 bits (59), Expect = 1.8
 Identities = 24/88 (27%), Positives = 41/88 (46%), Gaps = 9/88 (10%)
 Frame = +1

Query: 547  IQENANVSRPLTLPSVRANAF-----VPIVEARSLYLMGEARTL----EPRPRKVNLKVV 699
            I   A+V+R   LPSV  N       +P +E +  +     + L     PR  K  L+VV
Sbjct: 2877 INRFAHVARKHKLPSVCLNQLTKIYTLPNIEIQEAFYKLREQVLCYLQNPRDLKTGLEVV 2936

Query: 700  LGRPVLKRPLKRTTKFLPPRGKFLKAQN 783
                ++    ++ ++F+  +GKFL+  N
Sbjct: 2937 TNTNLMYFNSRQKSEFVTLKGKFLEKLN 2964


>SPAC20G8.05c |cdc15||cell division control protein
           Cdc15|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 927

 Score = 27.5 bits (58), Expect = 2.4
 Identities = 20/65 (30%), Positives = 30/65 (46%), Gaps = 6/65 (9%)
 Frame = +2

Query: 104 AQEDRSSNCSSRK--GY----PRR*RIHRYNGKAFAGHRRGEHRGEPSSLSPTPIQPDAV 265
           +Q+  SSN S+R   GY    P     HRY   +    R+   R    + SP P   ++V
Sbjct: 790 SQKSTSSNTSNRNNGGYSGSRPSSEMGHRYGSMSGRSMRQVSQRSTSRARSPEPTNRNSV 849

Query: 266 LSENI 280
            S+N+
Sbjct: 850 QSKNV 854


>SPBC354.10 |||RNAPII degradation factor |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 963

 Score = 26.6 bits (56), Expect = 4.3
 Identities = 16/55 (29%), Positives = 27/55 (49%)
 Frame = +3

Query: 81  PTPELQEELKKIAQAIVAPAKGILAADESTGTMGKRLQDIGVENTEENRRRYRQL 245
           P PE ++E  K+A++   P K   +A ES     K  +++  + +  N   YR L
Sbjct: 477 PKPEAKKEASKVAESTKIPKKQHTSAYESRAPQSKVPENL--KESHVNETPYRGL 529


>SPCC188.07 |ccq1||telomere maintenence protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 735

 Score = 26.6 bits (56), Expect = 4.3
 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 1/77 (1%)
 Frame = +2

Query: 275 NISGVILFHETLYQKADDGTPLVSLLEKKGIIPGIKVDKGVVPLFGSEDECT-TQGLDDL 451
           NI GV+    +  ++  + + L +L EK G    I          GSE   + T+   D+
Sbjct: 357 NIVGVVATLSSSSEENSEASNLSTLFEKSGNFEEI---------LGSESHSSITEKTRDI 407

Query: 452 AQRCAQYKKDGCHFAKW 502
           A+  A + K+G +F+ W
Sbjct: 408 AKNVATWLKNGENFSSW 424


>SPCC24B10.19c |||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 455

 Score = 25.8 bits (54), Expect = 7.5
 Identities = 19/57 (33%), Positives = 27/57 (47%)
 Frame = +2

Query: 119 SSNCSSRKGYPRR*RIHRYNGKAFAGHRRGEHRGEPSSLSPTPIQPDAVLSENISGV 289
           + + SSRK Y R   I +Y    FA       R  P+S +  P++  AV S + S V
Sbjct: 25  AEDLSSRKTYARPVLIRQYRSLRFANKEENICRLTPNS-AFVPVRDSAVASISTSKV 80


>SPBP4H10.15 |||aconitate hydratase|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 905

 Score = 25.4 bits (53), Expect = 9.9
 Identities = 10/36 (27%), Positives = 23/36 (63%)
 Frame = +2

Query: 350 LEKKGIIPGIKVDKGVVPLFGSEDECTTQGLDDLAQ 457
           L+K+G++P   V++       +ED+ +T+G++ L +
Sbjct: 703 LKKQGVLPLTFVNEADYEKIDAEDKVSTRGIEQLLE 738


>SPAC15A10.02 |taf12||transcription factor TFIID complex subunit A
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 450

 Score = 25.4 bits (53), Expect = 9.9
 Identities = 11/48 (22%), Positives = 22/48 (45%)
 Frame = +1

Query: 433 PGSGRPRPALRPVQEGRLPLRQVALLLKIGRNTPSYQAIQENANVSRP 576
           PG+   RP+  PV + +   ++   L  +      YQ + +N  ++ P
Sbjct: 8   PGTPVQRPSAGPVNQAQFSQQRTNQLTSLLHTMTMYQQLAQNVGLNTP 55


>SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein
           homolog|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2609

 Score = 25.4 bits (53), Expect = 9.9
 Identities = 16/49 (32%), Positives = 24/49 (48%), Gaps = 2/49 (4%)
 Frame = +2

Query: 212 HRGEPSSLSPTPIQPDAVLSENISGVILFHETLYQKADD--GTPLVSLL 352
           ++  PS+L+P   + DA++SEN           Y+  D     PLV LL
Sbjct: 530 NQSTPSTLAPNVAETDALVSENTGAASQKTSKSYKTNDSLKVPPLVPLL 578


>SPBP8B7.26 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 262

 Score = 25.4 bits (53), Expect = 9.9
 Identities = 12/30 (40%), Positives = 16/30 (53%)
 Frame = +1

Query: 541 QAIQENANVSRPLTLPSVRANAFVPIVEAR 630
           Q  Q NAN +    LP+  ANA +P+   R
Sbjct: 165 QTYQSNANYTASSPLPTASANAPLPVPPPR 194


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,590,163
Number of Sequences: 5004
Number of extensions: 79295
Number of successful extensions: 179
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 173
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 179
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 404442380
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).