SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30055
         (803 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC1105.09 |ubc15||ubiquitin conjugating enzyme Ubc15|Schizosac...    58   1e-09
SPAC1250.03 |ubc14||ubiquitin conjugating enzyme Ubc14|Schizosac...    48   1e-06
SPAC10F6.05c |ubc6||ubiquitin conjugating enzyme Ubc6|Schizosacc...    40   3e-04
SPBP16F5.04 |ubc3|ubcp3|ubiquitin conjugating enzyme Ubc3|Schizo...    37   0.003
SPAC18B11.07c |rhp6|ubc2|Rad6 homolog, ubiquitin conjugating enz...    35   0.016
SPBC6B1.02 |ppk30||Ark1/Prk1 family protein kinase Ppk30|Schizos...    33   0.063
SPCC1259.15c |ubc11|ubcdp, ubcp4|ubiquitin conjugating enzyme E2...    33   0.063
SPBC1198.09 |ubc16||ubiquitin conjugating enzyme Ubc16|Schizosac...    32   0.11 
SPBC119.02 |ubc4||ubiquitin conjugating enzyme Ubc4|Schizosaccha...    31   0.25 
SPBC211.07c |ubc8||ubiquitin conjugating enzyme Ubc8|Schizosacch...    30   0.33 
SPAC30D11.13 |hus5|ubc9|SUMO conjugating enzyme Hus5|Schizosacch...    30   0.44 
SPBC2D10.20 |ubc1||ubiquitin conjugating enzyme Ubc1|Schizosacch...    29   1.0  
SPCC757.05c |||acetylornithine deacetylase |Schizosaccharomyces ...    27   2.4  
SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyc...    27   2.4  
SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase |Schizosa...    27   4.1  
SPCC777.10c |ubc12||ubiquitin conjugating enzyme Ubc12|Schizosac...    26   5.5  
SPAC17C9.03 |tif471||translation initiation factor eIF4G |Schizo...    26   7.2  
SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3 |Schizosa...    25   9.5  
SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31 |Schizo...    25   9.5  
SPAC1952.11c |ure2||urease |Schizosaccharomyces pombe|chr 1|||Ma...    25   9.5  

>SPBC1105.09 |ubc15||ubiquitin conjugating enzyme
           Ubc15|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 167

 Score = 58.4 bits (135), Expect = 1e-09
 Identities = 27/79 (34%), Positives = 46/79 (58%)
 Frame = +2

Query: 356 VPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSRHT*N 535
           +P+S++ + L  + K +Q+ P +GF V L+ + ++FEWEV I GP DTLY+      T +
Sbjct: 1   MPSSASEQLLRKQLKEIQKNPPQGFSVGLVDDKSIFEWEVMIIGPEDTLYEGGFFHATLS 60

Query: 536 SPLTTRIHHHPLGFLTKVW 592
            P    +    + F T++W
Sbjct: 61  FPQDYPLMPPKMKFTTEIW 79



 Score = 39.5 bits (88), Expect = 5e-04
 Identities = 14/18 (77%), Positives = 17/18 (94%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPP 647
           HPNV+ NG++CISILHPP
Sbjct: 80  HPNVHPNGEVCISILHPP 97


>SPAC1250.03 |ubc14||ubiquitin conjugating enzyme
           Ubc14|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 155

 Score = 48.4 bits (110), Expect = 1e-06
 Identities = 27/83 (32%), Positives = 41/83 (49%)
 Frame = +2

Query: 344 MSNTVPTSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDTSR 523
           M++  P+SS  R L  EY  L+E P+   RV L+ +DNLF W     GP D++Y      
Sbjct: 1   MASASPSSS--RRLTKEYSDLREHPIPDIRVNLV-DDNLFHWACTALGPSDSVYAGGKFH 57

Query: 524 HT*NSPLTTRIHHHPLGFLTKVW 592
            +   PL        + F T+++
Sbjct: 58  FSLKFPLDYPFQPPTIEFTTRIY 80



 Score = 30.7 bits (66), Expect = 0.25
 Identities = 11/22 (50%), Positives = 15/22 (68%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   +KFP DYP+ PP+I
Sbjct: 52  AGGKFHFSLKFPLDYPFQPPTI 73


>SPAC10F6.05c |ubc6||ubiquitin conjugating enzyme
           Ubc6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 227

 Score = 40.3 bits (90), Expect = 3e-04
 Identities = 21/49 (42%), Positives = 27/49 (55%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           +  A + L  EY +LQ+ PVE    K   E N+ EW   I GPPDT Y+
Sbjct: 3   SKGAYKRLMKEYLALQKNPVELVDAKPATE-NILEWHYIITGPPDTPYE 50



 Score = 34.3 bits (75), Expect = 0.021
 Identities = 15/48 (31%), Positives = 24/48 (50%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIRVFN*SLGIQMYMKTEIFAYRFSTRPWD 654
           G +   + FPPDYP+ PP+IR+   S   Q   +  +    F  + W+
Sbjct: 52  GQYHGTLIFPPDYPFKPPAIRMITPSGRFQTNTRLCLSFSDFHPKSWN 99


>SPBP16F5.04 |ubc3|ubcp3|ubiquitin conjugating enzyme
           Ubc3|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 166

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 17/39 (43%), Positives = 27/39 (69%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSV 710
           HPNVY++G +CISILH P    +++ ++ +   +P QSV
Sbjct: 80  HPNVYKDGTVCISILHAPGDDPNMYESS-SERWSPVQSV 117



 Score = 36.7 bits (81), Expect = 0.004
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQ 508
           ALR L  EYK L E   +G       ED+ F W+  I GP  T ++
Sbjct: 6   ALRRLMKEYKELTENGPDGITAGPSNEDDFFTWDCLIQGPDGTPFE 51



 Score = 31.9 bits (69), Expect = 0.11
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSIR 573
           G     G + A +KFP DYP  PP+++
Sbjct: 47  GTPFEGGLYPATLKFPSDYPLGPPTLK 73


>SPAC18B11.07c |rhp6|ubc2|Rad6 homolog, ubiquitin conjugating enzyme
           E2 Rhp6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 151

 Score = 34.7 bits (76), Expect = 0.016
 Identities = 16/52 (30%), Positives = 28/52 (53%)
 Frame = +2

Query: 362 TSSALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLYQVDT 517
           +++A R L  ++K +Q++P  G     +  DN+  W   I GP DT ++  T
Sbjct: 2   STTARRRLMRDFKRMQQDPPAGVSASPVS-DNVMLWNAVIIGPADTPFEDGT 52



 Score = 31.5 bits (68), Expect = 0.14
 Identities = 11/15 (73%), Positives = 13/15 (86%)
 Frame = +3

Query: 594 HPNVYENGDLCISIL 638
           HPNVY NG+LC+ IL
Sbjct: 78  HPNVYANGELCLDIL 92


>SPBC6B1.02 |ppk30||Ark1/Prk1 family protein kinase
           Ppk30|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 953

 Score = 32.7 bits (71), Expect = 0.063
 Identities = 23/72 (31%), Positives = 36/72 (50%), Gaps = 1/72 (1%)
 Frame = +3

Query: 588 SGHPNVYENGDLCISILHPPVG*SSVWRTAPANVGNPTQSVRNRYSPSGNLNP-SKEPEH 764
           S  PN+Y+     + +   P+    V+    A+  NP ++   R +PSG+L P S  P H
Sbjct: 312 SHRPNIYQTLKEIMEMQGTPLKLPDVYGGVNASTYNPPRAPLQR-TPSGSLTPLSSRPAH 370

Query: 765 LSVPGERSMPTV 800
            S+P    +PTV
Sbjct: 371 TSLP---PIPTV 379


>SPCC1259.15c |ubc11|ubcdp, ubcp4|ubiquitin conjugating enzyme E2-C
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 176

 Score = 32.7 bits (71), Expect = 0.063
 Identities = 12/18 (66%), Positives = 14/18 (77%)
 Frame = +1

Query: 517 FKAHMKFPPDYPYSPPSI 570
           FK  M FP +YPYSPP+I
Sbjct: 78  FKISMSFPANYPYSPPTI 95


>SPBC1198.09 |ubc16||ubiquitin conjugating enzyme
           Ubc16|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 160

 Score = 31.9 bits (69), Expect = 0.11
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%)
 Frame = +2

Query: 365 SSALRALALEYKSLQEEPVEGFRV-KLLGEDNLFEWEVAIFGPPDTLYQ 508
           +S+++ L  EY S Q   + G  + K + + ++F W+  I GP +T Y+
Sbjct: 2   NSSIKRLHKEYASFQAGDISGLLLLKPVTDVDMFHWKAVIEGPTETPYE 50


>SPBC119.02 |ubc4||ubiquitin conjugating enzyme
           Ubc4|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 147

 Score = 30.7 bits (66), Expect = 0.25
 Identities = 15/45 (33%), Positives = 23/45 (51%)
 Frame = +2

Query: 371 ALRALALEYKSLQEEPVEGFRVKLLGEDNLFEWEVAIFGPPDTLY 505
           AL+ +  E   L ++P        +G+D LF W+  I GP D+ Y
Sbjct: 2   ALKRINRELADLGKDPPSSCSAGPVGDD-LFHWQATIMGPADSPY 45



 Score = 27.9 bits (59), Expect = 1.8
 Identities = 9/22 (40%), Positives = 13/22 (59%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSI 570
           + G F   + FP DYP+ PP +
Sbjct: 46  AGGVFFLSIHFPTDYPFKPPKV 67



 Score = 26.2 bits (55), Expect = 5.5
 Identities = 8/15 (53%), Positives = 11/15 (73%)
 Frame = +3

Query: 594 HPNVYENGDLCISIL 638
           HPN+  NG +C+ IL
Sbjct: 75  HPNINSNGSICLDIL 89


>SPBC211.07c |ubc8||ubiquitin conjugating enzyme
           Ubc8|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 184

 Score = 30.3 bits (65), Expect = 0.33
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +1

Query: 505 SSGYFKAHMKFPPDYPYSPPSIRVFN 582
           S G +K H++ P +YP+  PSI   N
Sbjct: 45  SGGIWKVHVELPSEYPWKSPSIGFVN 70


>SPAC30D11.13 |hus5|ubc9|SUMO conjugating enzyme
           Hus5|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 157

 Score = 29.9 bits (64), Expect = 0.44
 Identities = 11/20 (55%), Positives = 15/20 (75%)
 Frame = +3

Query: 594 HPNVYENGDLCISILHPPVG 653
           HPNVY +G +C+SIL+   G
Sbjct: 83  HPNVYPSGTVCLSILNEEEG 102



 Score = 27.1 bits (57), Expect = 3.1
 Identities = 10/21 (47%), Positives = 12/21 (57%)
 Frame = +1

Query: 511 GYFKAHMKFPPDYPYSPPSIR 573
           G +K  M FP +YP  PP  R
Sbjct: 56  GLYKLTMAFPEEYPTRPPKCR 76


>SPBC2D10.20 |ubc1||ubiquitin conjugating enzyme
           Ubc1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 217

 Score = 28.7 bits (61), Expect = 1.0
 Identities = 10/26 (38%), Positives = 14/26 (53%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSI 570
           G     GYF   ++ P DYP+ PP +
Sbjct: 45  GTPYEGGYFVVDIEIPIDYPFRPPKM 70


>SPCC757.05c |||acetylornithine deacetylase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 400

 Score = 27.5 bits (58), Expect = 2.4
 Identities = 11/27 (40%), Positives = 16/27 (59%)
 Frame = +2

Query: 413 EPVEGFRVKLLGEDNLFEWEVAIFGPP 493
           E ++G  +K +      +WEVAIFG P
Sbjct: 186 EEIDGIGMKTVANKLNADWEVAIFGEP 212


>SPBC336.03 |efc25||exchange factor Cdc25p-like|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 987

 Score = 27.5 bits (58), Expect = 2.4
 Identities = 16/41 (39%), Positives = 21/41 (51%)
 Frame = -3

Query: 501 SVSGGPKIATSHSNRLSSPSNLTRKPSTGSSCRLLYSNAKA 379
           S S  P +  S  +R SS  +LTR+PS  S    L  N +A
Sbjct: 85  STSPFPYLKGSFDDRFSSTHSLTRQPSPRSPLTPLKGNTRA 125


>SPBC2G2.02 |syj1||inositol-polyphosphate 5-phosphatase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1076

 Score = 26.6 bits (56), Expect = 4.1
 Identities = 12/31 (38%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
 Frame = +2

Query: 344 MSNTVPTS-SALRALALEYKSLQEEPVEGFR 433
           M ++VP + ++L     E+ +L E+P+EGFR
Sbjct: 22  MFHSVPQNKNSLSVCVAEFTALSEKPLEGFR 52


>SPCC777.10c |ubc12||ubiquitin conjugating enzyme
           Ubc12|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 177

 Score = 26.2 bits (55), Expect = 5.5
 Identities = 10/30 (33%), Positives = 16/30 (53%)
 Frame = +1

Query: 493 GYTLSSGYFKAHMKFPPDYPYSPPSIRVFN 582
           GY    G FK  ++   +YP+ PP ++  N
Sbjct: 63  GY-YKGGKFKFRIQIDDNYPHDPPKVKCLN 91


>SPAC17C9.03 |tif471||translation initiation factor eIF4G
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1403

 Score = 25.8 bits (54), Expect = 7.2
 Identities = 14/26 (53%), Positives = 17/26 (65%), Gaps = 2/26 (7%)
 Frame = -3

Query: 489 GPKIATSHSNRLSSPSN--LTRKPST 418
           GP+  TS SN  +SP+N   T KPST
Sbjct: 230 GPRPTTSASNTNTSPANGAPTNKPST 255


>SPAC167.07c ||SPAC57A7.03c|ubiquitin-protein ligase E3
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1029

 Score = 25.4 bits (53), Expect = 9.5
 Identities = 8/18 (44%), Positives = 12/18 (66%)
 Frame = -3

Query: 612 FHIHLDAQTLVKNPNGWW 559
           FH   D Q ++KN +G+W
Sbjct: 475 FHKKFDVQNVLKNDSGYW 492


>SPBC8D2.20c |sec31||COPII-coated vesicle component Sec31
            |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1224

 Score = 25.4 bits (53), Expect = 9.5
 Identities = 17/50 (34%), Positives = 24/50 (48%), Gaps = 4/50 (8%)
 Frame = +3

Query: 627  ISILHPPVG*SSVWRTAPANVGNPTQSVRNRYSP---SG-NLNPSKEPEH 764
            +S L PP   +S+  +APA    P   V   Y P   SG  + P ++P H
Sbjct: 904  VSTLPPPPPTASMTASAPAIASPPPPKVGETYHPPTASGTRVPPVQQPSH 953


>SPAC1952.11c |ure2||urease |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 835

 Score = 25.4 bits (53), Expect = 9.5
 Identities = 15/44 (34%), Positives = 18/44 (40%)
 Frame = -2

Query: 331 IYSTFTTYLNKII*TYHFGTLYAVHVPPGISTRHNNNELEILVN 200
           +  TF  + N+ I TYH       H P  IS   N N L    N
Sbjct: 526 VEGTFKAFKNRTIHTYHVEGAGGGHAPDIISLVQNPNILPSSTN 569


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,699,998
Number of Sequences: 5004
Number of extensions: 84815
Number of successful extensions: 258
Number of sequences better than 10.0: 20
Number of HSP's better than 10.0 without gapping: 229
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 256
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 390427050
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).