SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30049
         (727 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1006.07 |||translation initiation factor eIF4A|Schizosacchar...   112   4e-26
SPAC1F5.10 |||ATP-dependent RNA helicase, eIF4A related|Schizosa...   105   6e-24
SPBC776.09 |ste13||ATP-dependent RNA helicase Ste13|Schizosaccha...    64   3e-11
SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyc...    56   5e-09
SPCC1494.06c |||ATP-dependent RNA helicase Dbp9 |Schizosaccharom...    53   5e-08
SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomy...    53   5e-08
SPAC17G6.14c |uap56||ATP-dependent RNA helicase Uap56|Schizosacc...    51   2e-07
SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac...    50   3e-07
SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8 |Schizosaccha...    47   2e-06
SPAC30D11.03 |drs1||ATP-dependent RNA helicase Drs1 |Schizosacch...    46   6e-06
SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomy...    44   2e-05
SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosacc...    44   2e-05
SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosacchar...    42   9e-05
SPBC24C6.02 |||ATP-dependent RNA helicase Spb4 |Schizosaccharomy...    40   4e-04
SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Su...    39   6e-04
SPCC63.11 |prp28||U5 snRNP-associated protein Prp28 |Schizosacch...    39   8e-04
SPBC4F6.07c |||ATP-dependent RNA helicase Mak5 |Schizosaccharomy...    36   0.004
SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomy...    36   0.004
SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccha...    33   0.042
SPAC22F3.08c |rok1||ATP-dependent RNA helicase Rok1 |Schizosacch...    31   0.13 
SPBC21H7.04 |||ATP-dependent RNA helicase Dbp7 |Schizosaccharomy...    29   0.51 
SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G family|Schizosaccha...    28   1.2  
SPCC285.03 |||ATP-dependent RNA helicase Dbp6|Schizosaccharomyce...    27   2.1  
SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccha...    27   2.7  
SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharo...    27   3.6  
SPAC2E12.03c |||G-protein coupled receptor |Schizosaccharomyces ...    27   3.6  
SPBC1198.06c |||mannan endo-1,6-alpha-mannosidase |Schizosacchar...    26   4.8  
SPAC27E2.07 |pvg2|mug53|galactose residue biosynthesis protein P...    26   4.8  
SPBC3F6.05 |rga1||GTPase activating protein Rga1|Schizosaccharom...    26   4.8  
SPCC736.08 |cbf11||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual    26   6.3  
SPBC25H2.03 |||vacuolar protein involved in phosphoinositide met...    26   6.3  
SPCC1906.04 |wtf20||wtf element Wtf20|Schizosaccharomyces pombe|...    25   8.3  

>SPAC1006.07 |||translation initiation factor
           eIF4A|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 392

 Score =  112 bits (270), Expect = 4e-26
 Identities = 51/67 (76%), Positives = 62/67 (92%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSIS+LQ+IDTS+++CQALILAPTRELAQQIQKVV+ALGD +N +CHACIGGT VR
Sbjct: 69  KTATFSISVLQKIDTSLKQCQALILAPTRELAQQIQKVVVALGDLMNVECHACIGGTLVR 128

Query: 434 EDIRQLE 454
           +D+  L+
Sbjct: 129 DDMAALQ 135



 Score =  103 bits (246), Expect = 3e-23
 Identities = 46/60 (76%), Positives = 55/60 (91%)
 Frame = +3

Query: 78  LHTDWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           + T++D+V++TFDDMNLK ELLRGIYAYGFE+PSAIQQRAIMP +  RDV+AQAQSGTGK
Sbjct: 10  IETNYDEVIDTFDDMNLKPELLRGIYAYGFERPSAIQQRAIMPILGERDVLAQAQSGTGK 69



 Score = 31.1 bits (67), Expect = 0.17
 Identities = 14/27 (51%), Positives = 19/27 (70%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV+DMI       + +++FVLDEADE
Sbjct: 146 GRVHDMIQRRALPTDAVQMFVLDEADE 172


>SPAC1F5.10 |||ATP-dependent RNA helicase, eIF4A
           related|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 394

 Score =  105 bits (252), Expect = 6e-24
 Identities = 48/67 (71%), Positives = 58/67 (86%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTATFSI ILQ ID S+R+ QALIL+PTRELA QIQ VV+ALGDH+N +CHACIGGT+V 
Sbjct: 71  KTATFSIGILQSIDLSVRDTQALILSPTRELAVQIQNVVLALGDHMNVQCHACIGGTSVG 130

Query: 434 EDIRQLE 454
            DI++L+
Sbjct: 131 NDIKKLD 137



 Score = 84.6 bits (200), Expect = 1e-17
 Identities = 38/52 (73%), Positives = 46/52 (88%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V +F++MNLKE+LLRGIYAYG+E PSA+Q RAI+   +GRDVIAQAQSGTGK
Sbjct: 20  VSSFEEMNLKEDLLRGIYAYGYETPSAVQSRAIIQICKGRDVIAQAQSGTGK 71



 Score = 29.1 bits (62), Expect = 0.68
 Identities = 13/27 (48%), Positives = 16/27 (59%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEADE 567
           GRV DMI         +K+ +LDEADE
Sbjct: 148 GRVTDMIRRRNLRTRNVKMLILDEADE 174


>SPBC776.09 |ste13||ATP-dependent RNA helicase
           Ste13|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 485

 Score = 63.7 bits (148), Expect = 3e-11
 Identities = 32/66 (48%), Positives = 41/66 (62%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVR 433
           KTA F I  L+++DT   + Q LIL PTRELA Q  +V   LG H+N K     GGT +R
Sbjct: 94  KTAAFVIPSLEKVDTKKSKIQTLILVPTRELALQTSQVCKTLGKHMNVKVMVTTGGTTLR 153

Query: 434 EDIRQL 451
           +DI +L
Sbjct: 154 DDIIRL 159



 Score = 60.1 bits (139), Expect = 3e-10
 Identities = 26/49 (53%), Positives = 37/49 (75%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F+D  LK ELL GI+  GFE+PS IQ+ +I   + GRD++A+A++GTGK
Sbjct: 46  FEDYYLKRELLMGIFEAGFERPSPIQEESIPIALSGRDILARAKNGTGK 94


>SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 503

 Score = 56.0 bits (129), Expect = 5e-09
 Identities = 26/54 (48%), Positives = 41/54 (75%), Gaps = 2/54 (3%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQG--RDVIAQAQSGTGK 257
           V++F+++ LK ELL+GIY+  F+KPS IQ++A+   +    R++I Q+QSGTGK
Sbjct: 113 VKSFEELELKPELLKGIYSMKFQKPSKIQEKALPLLLSNPPRNMIGQSQSGTGK 166



 Score = 50.0 bits (114), Expect = 3e-07
 Identities = 22/49 (44%), Positives = 35/49 (71%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAK 400
           KTA F++++L ++D S+ + QA+ LAP+RELA+QI  VV  +G +   K
Sbjct: 166 KTAAFALTMLSRVDASVPKPQAICLAPSRELARQIMDVVTEMGKYTEVK 214



 Score = 26.6 bits (56), Expect = 3.6
 Identities = 13/26 (50%), Positives = 17/26 (65%)
 Frame = +1

Query: 487 GRVYDMIIVVRFHANTIKLFVLDEAD 564
           G V D++   +  A  IK+FVLDEAD
Sbjct: 239 GTVMDLMKRRQLDARDIKVFVLDEAD 264


>SPCC1494.06c |||ATP-dependent RNA helicase Dbp9
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 595

 Score = 52.8 bits (121), Expect = 5e-08
 Identities = 22/51 (43%), Positives = 35/51 (68%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +TF D NL   L R I+   FEKP+++Q   I   ++G+D++AQA++G+GK
Sbjct: 14  KTFSDFNLDPRLQRAIHKCEFEKPTSVQSETIPLALEGKDLVAQARTGSGK 64



 Score = 36.3 bits (80), Expect = 0.004
 Identities = 28/65 (43%), Positives = 35/65 (53%), Gaps = 6/65 (9%)
 Frame = +2

Query: 254 KTATFSISILQ------QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACI 415
           KTA + I IL+      QID + R   AL+L PTRELAQQ+  V+    + L A C   I
Sbjct: 64  KTAAYLIPILELLLKQKQIDENQRGIFALLLVPTRELAQQVYNVL----EKLTAFCSKHI 119

Query: 416 GGTNV 430
              NV
Sbjct: 120 RFINV 124


>SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 578

 Score = 52.8 bits (121), Expect = 5e-08
 Identities = 24/57 (42%), Positives = 36/57 (63%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSL 272
           +E F D+ L E + + I   GFE  + IQ+R+I P + GRDV+  A++G+GK L  L
Sbjct: 88  IEKFSDLQLSENIQKAIKEMGFETMTEIQKRSIPPLLAGRDVLGAAKTGSGKTLAFL 144



 Score = 27.9 bits (59), Expect = 1.6
 Identities = 17/44 (38%), Positives = 24/44 (54%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           +I++PTRELA QI  V   L  + +      IGG N R +  +L
Sbjct: 165 IIISPTRELALQIFGVAKELLKYHHQTFGIVIGGANRRAEADKL 208


>SPAC17G6.14c |uap56||ATP-dependent RNA helicase
           Uap56|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 50.8 bits (116), Expect = 2e-07
 Identities = 27/49 (55%), Positives = 30/49 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F D  LK ELLR I   GFE PS +QQ  I   I G DV+ QA+SG GK
Sbjct: 53  FRDFLLKPELLRAITDSGFEHPSEVQQVCIPQSILGTDVLCQAKSGMGK 101



 Score = 42.3 bits (95), Expect = 7e-05
 Identities = 24/64 (37%), Positives = 35/64 (54%), Gaps = 1/64 (1%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTNV 430
           KTA F +S LQQI+    E   L+L  TRELA QI+        +L + +     GG N+
Sbjct: 101 KTAVFVLSTLQQIEPVDGEVSVLVLCHTRELAFQIKNEYARFSKYLPDVRTAVFYGGINI 160

Query: 431 REDI 442
           ++D+
Sbjct: 161 KQDM 164


>SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 848

 Score = 50.0 bits (114), Expect = 3e-07
 Identities = 21/49 (42%), Positives = 33/49 (67%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           F  M L + LLR I+  GF+ P+ IQ++ I   ++GRDV+  A++G+GK
Sbjct: 71  FQSMGLNQTLLRAIFKKGFKAPTPIQRKTIPLLLEGRDVVGMARTGSGK 119



 Score = 39.1 bits (87), Expect = 6e-04
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KTA F I +++ + +++     +ALIL+P RELA Q  KVV       + +  A +GG +
Sbjct: 119 KTAAFVIPMIEHLKSTLANSNTRALILSPNRELALQTVKVVKDFSKGTDLRSVAIVGGVS 178

Query: 428 VREDIRQL 451
           + E    L
Sbjct: 179 LEEQFSLL 186


>SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 453

 Score = 47.2 bits (107), Expect = 2e-06
 Identities = 28/74 (37%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +2

Query: 224 CYRSSPVRNWKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKC 403
           C   +   + KTA F++ I+++         ALIL PTRELA QI +   ALG +LN K 
Sbjct: 47  CIGGAKTGSGKTAAFALPIIEKWSKDPSGIFALILTPTRELAIQIDEQFAALGANLNLKH 106

Query: 404 HACIGGTN-VREDI 442
              +GG + +R+ I
Sbjct: 107 ALIVGGMDMIRQSI 120



 Score = 34.3 bits (75), Expect = 0.018
 Identities = 15/51 (29%), Positives = 30/51 (58%)
 Frame = +3

Query: 105 ETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++F D+ +   L+  + A    +P+ IQ+  I   ++GR+ I  A++G+GK
Sbjct: 7   KSFSDLGISPWLIDTLKALAIYEPTDIQEGVIAQILEGRNCIGGAKTGSGK 57


>SPAC30D11.03 |drs1||ATP-dependent RNA helicase Drs1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 754

 Score = 46.0 bits (104), Expect = 6e-06
 Identities = 19/50 (38%), Positives = 31/50 (62%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           +F  MNL   +L+G+   GFE P+ IQ + I   + G+D++  A +G+GK
Sbjct: 260 SFQSMNLSRPILKGLSNLGFEVPTQIQDKTIPLALLGKDIVGAAVTGSGK 309



 Score = 39.1 bits (87), Expect = 6e-04
 Identities = 22/69 (31%), Positives = 35/69 (50%), Gaps = 3/69 (4%)
 Frame = +2

Query: 254 KTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KTA F + IL+++      +   + LIL PTRELA Q   V   +    +     CIGG 
Sbjct: 309 KTAAFIVPILERLLYRPKKVPTTRVLILCPTRELAMQCHSVATKIASFTDIMVCLCIGGL 368

Query: 425 NVREDIRQL 451
           +++   ++L
Sbjct: 369 SLKLQEQEL 377


>SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 465

 Score = 44.4 bits (100), Expect = 2e-05
 Identities = 21/55 (38%), Positives = 33/55 (60%)
 Frame = +3

Query: 93  DQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           ++  +TF ++ + +EL       GF+ P+ IQQ AI   +  RDVI  AQ+G+GK
Sbjct: 42  NEAPKTFKELGVIDELCEACEKLGFKTPTPIQQEAIPVVLNKRDVIGLAQTGSGK 96



 Score = 43.2 bits (97), Expect = 4e-05
 Identities = 20/59 (33%), Positives = 36/59 (61%)
 Frame = +2

Query: 254 KTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 430
           KTA F++ ++Q++  +     A++LAPTRELA QI +   A+G  +  +    +GG ++
Sbjct: 96  KTAAFALPVIQELWNNPSPFFAVVLAPTRELAYQISEQFEAIGGSIGVRSVVIVGGMDM 154


>SPCC10H11.01 |prp11||ATP-dependent RNA helicase
           Prp11|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1014

 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 22/62 (35%), Positives = 36/62 (58%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLL 266
           D  + V ++    L  + +  I + G+EKP++IQ +AI     GRDVI  A++G+GK + 
Sbjct: 412 DCPKPVTSWSQCGLSAQTISVINSLGYEKPTSIQAQAIPAITSGRDVIGVAKTGSGKTIA 471

Query: 267 SL 272
            L
Sbjct: 472 FL 473



 Score = 30.3 bits (65), Expect = 0.29
 Identities = 16/46 (34%), Positives = 24/46 (52%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           A+I+ PTRELA QI +        LN +     GG  +++ I  L+
Sbjct: 494 AIIMTPTRELAVQIFRECKPFLKLLNIRACCAYGGAPIKDQIADLK 539


>SPBP8B7.16c |dbp2||ATP-dependent RNA helicase
           Dbp2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 550

 Score = 41.9 bits (94), Expect = 9e-05
 Identities = 19/54 (35%), Positives = 32/54 (59%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V TF++      +L+ +   GFE P+ IQQ+A    + GRD++  + +G+GK L
Sbjct: 121 VTTFEEAGFPNYVLKEVKQLGFEAPTPIQQQAWPMAMSGRDMVGISATGSGKTL 174



 Score = 30.7 bits (66), Expect = 0.22
 Identities = 18/44 (40%), Positives = 21/44 (47%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           L+LAPTRELA QIQ+     G     +     GG      IR L
Sbjct: 199 LVLAPTRELAVQIQQECTKFGKSSRIRNTCVYGGVPRGPQIRDL 242


>SPBC24C6.02 |||ATP-dependent RNA helicase Spb4 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 606

 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 18/61 (29%), Positives = 36/61 (59%)
 Frame = +3

Query: 108 TFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLLLSLYRFYN 287
           +F  +N+ + L   + A GF+K + +Q  AI   ++ +D++ +A +G+GK L  L   ++
Sbjct: 2   SFQSINIDKWLKNAVAAQGFKKMTPVQANAIPLFLKNKDLVVEAVTGSGKTLAYLLPCFD 61

Query: 288 K 290
           K
Sbjct: 62  K 62



 Score = 27.5 bits (58), Expect = 2.1
 Identities = 15/25 (60%), Positives = 16/25 (64%)
 Frame = +2

Query: 293 DTSIRECQALILAPTRELAQQIQKV 367
           DT      ALI+APTRELA QI  V
Sbjct: 67  DTDETGLGALIVAPTRELATQIFNV 91


>SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase
           Sum3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 636

 Score = 39.1 bits (87), Expect = 6e-04
 Identities = 19/52 (36%), Positives = 30/52 (57%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           V  F    L   LL+ I   G+ +P+ +Q+ +I     GRD++A AQ+G+GK
Sbjct: 168 VNEFTSPPLNSHLLQNIKLSGYTQPTPVQKNSIPIVTSGRDLMACAQTGSGK 219



 Score = 30.3 bits (65), Expect = 0.29
 Identities = 18/45 (40%), Positives = 24/45 (53%)
 Frame = +2

Query: 320 LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLE 454
           LILAPTREL  QI +           +  A  GG ++R  IRQ++
Sbjct: 259 LILAPTRELVCQIHEESRKFCYRSWVRPCAVYGGADIRAQIRQID 303



 Score = 26.2 bits (55), Expect = 4.8
 Identities = 14/29 (48%), Positives = 16/29 (55%)
 Frame = +1

Query: 478 ALQGRVYDMIIVVRFHANTIKLFVLDEAD 564
           A  GR+ D+I   R     IK  VLDEAD
Sbjct: 311 ATPGRLVDLIDRGRISLANIKFLVLDEAD 339


>SPCC63.11 |prp28||U5 snRNP-associated protein Prp28
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score = 38.7 bits (86), Expect = 8e-04
 Identities = 17/57 (29%), Positives = 35/57 (61%)
 Frame = +3

Query: 87  DWDQVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           D    +  +++  L  E+L+ +    +++PS+IQ+ AI   +Q +D+I  A++G+GK
Sbjct: 243 DLPNPLRNWEEAGLPSEMLKVLKKVNYKEPSSIQRAAIPVLLQRKDLIGIAETGSGK 299



 Score = 36.7 bits (81), Expect = 0.003
 Identities = 19/45 (42%), Positives = 26/45 (57%)
 Frame = +2

Query: 317 ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQL 451
           A++LAPTRELAQQIQ       + L  +C + +GG    E   Q+
Sbjct: 328 AVVLAPTRELAQQIQVEGNKFAEPLGFRCVSVVGGHAFEEQSFQM 372


>SPBC4F6.07c |||ATP-dependent RNA helicase Mak5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 648

 Score = 36.3 bits (80), Expect = 0.004
 Identities = 19/54 (35%), Positives = 27/54 (50%)
 Frame = +3

Query: 102 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           V  +   +L  E+L  +   GF KP  IQ   I     G D+I +A +G+GK L
Sbjct: 121 VSAWAHFSLSPEMLGSLSKAGFSKPMPIQSLVIPEASIGFDIIGKADTGSGKTL 174



 Score = 36.3 bits (80), Expect = 0.004
 Identities = 24/68 (35%), Positives = 35/68 (51%), Gaps = 2/68 (2%)
 Frame = +2

Query: 254 KTATFSISILQQI--DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 427
           KT  F I IL+    +   +  QAL++APTRELA QI +    +    N +  +  GG  
Sbjct: 172 KTLAFGIPILEHCLRNVDAKYVQALVVAPTRELAHQICQHFELIKPSPNIRVMSITGGLA 231

Query: 428 VREDIRQL 451
           V++  R L
Sbjct: 232 VQKQQRLL 239


>SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 735

 Score = 36.3 bits (80), Expect = 0.004
 Identities = 21/70 (30%), Positives = 38/70 (54%), Gaps = 4/70 (5%)
 Frame = +2

Query: 254 KTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 421
           KT  F + +++ +     TS+    AL+++PTRELA Q  + ++ +G   +      IGG
Sbjct: 89  KTLAFIVPLIENLYRKKWTSLDGLGALVISPTRELAIQTFETLVKIGRLHSFSAGLIIGG 148

Query: 422 TNVREDIRQL 451
            N +E+  +L
Sbjct: 149 NNYKEEKERL 158



 Score = 31.5 bits (68), Expect = 0.13
 Identities = 15/56 (26%), Positives = 31/56 (55%)
 Frame = +3

Query: 96  QVVETFDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGKLL 263
           + V+ F ++ L +     +    F   + IQ++ I   ++GRD++  A++G+GK L
Sbjct: 36  ETVDHFAELPLTQPTKSALKNAHFITLTEIQKQCIPSALKGRDILGAAKTGSGKTL 91


>SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 578

 Score = 33.1 bits (72), Expect = 0.042
 Identities = 16/49 (32%), Positives = 30/49 (61%)
 Frame = +3

Query: 111 FDDMNLKEELLRGIYAYGFEKPSAIQQRAIMPCIQGRDVIAQAQSGTGK 257
           FD++++  +L  G+  Y  ++P+ IQ       + GRDV+  A++G+GK
Sbjct: 169 FDELDVSAKLREGLKNY--KEPTPIQAATWPYLLAGRDVVGIAETGSGK 215



 Score = 28.3 bits (60), Expect = 1.2
 Identities = 21/67 (31%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
 Frame = +2

Query: 254 KTATFSISILQQID---TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 424
           KT  F I  LQ ++    +    + L+++PTRELA Q  + + +L    N K     GG 
Sbjct: 215 KTVAFGIPALQYLNGLSDNKSVPRVLVVSPTRELAIQTYENLNSLIQGTNLKAVVVYGGA 274

Query: 425 NVREDIR 445
              E  R
Sbjct: 275 PKSEQAR 281


>SPAC22F3.08c |rok1||ATP-dependent RNA helicase Rok1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 481

 Score = 31.5 bits (68), Expect = 0.13
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)
 Frame = +2

Query: 236 SPVRNWKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQK 364
           +P  + KT  +   ILQ++   +    +A+I+APTREL +QI +
Sbjct: 90  APTGSGKTIAYLFPILQKLQLHVPGGYRAIIVAPTRELCEQIYR 133


>SPBC21H7.04 |||ATP-dependent RNA helicase Dbp7 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 709

 Score = 29.5 bits (63), Expect = 0.51
 Identities = 20/60 (33%), Positives = 29/60 (48%), Gaps = 4/60 (6%)
 Frame = +2

Query: 272 ISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGD----HLNAKCHACIGGTNVRED 439
           I + + + T      A+I+APTREL QQI  V   L +    H    C+  IGG   + +
Sbjct: 204 IRLPKNLHTRTSGIYAVIMAPTRELCQQIYNVANKLNNNPLSHWIVSCNV-IGGEKKKSE 262


>SPAC12G12.16c ||SPAC18B11.01c|nuclease, XP-G
           family|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 496

 Score = 28.3 bits (60), Expect = 1.2
 Identities = 14/40 (35%), Positives = 21/40 (52%)
 Frame = -1

Query: 481 VPTTYMNTTLQLANIFTDIGATNASMAFSIQVITKSYHHL 362
           +PT Y+   L    +FTD+ + N   +F I  I K + HL
Sbjct: 413 IPTDYIKKFLTAKKLFTDLPSNNELFSF-IHNIPKEFLHL 451


>SPCC285.03 |||ATP-dependent RNA helicase Dbp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 604

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 18/74 (24%), Positives = 35/74 (47%), Gaps = 1/74 (1%)
 Frame = +2

Query: 233 SSPVRNWKTATFSISILQQID-TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHA 409
           S+   + KT ++ I I+Q +   ++   + +++ PTREL  Q+ K           +  A
Sbjct: 179 SAATGSGKTLSYVIPIVQCLSHRTVPRLRCVVIVPTRELTVQVAKTFEYYMSGAGLQVCA 238

Query: 410 CIGGTNVREDIRQL 451
             G  ++R +  QL
Sbjct: 239 WTGQKSLRHETYQL 252


>SPAPJ696.01c |vps17||retromer complex subunit
           Vps17|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 549

 Score = 27.1 bits (57), Expect = 2.7
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +1

Query: 277 DSTTNRYKHS*MSSFDPGSHKRAGPTNSEGGDSS 378
           D+ TNR +    SSFD  S     P+N++G  ++
Sbjct: 487 DAWTNRKRPGYSSSFDGSSQSTFNPSNNDGAHNT 520


>SPAC23D3.13c |||guanyl-nucleotide exchange factor|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1616

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 9/29 (31%), Positives = 20/29 (68%)
 Frame = -2

Query: 636  NQLTNHLEDHQWIWSLENLWNNIFISFIK 550
            N + +   D++++WSLE+++ N  +S +K
Sbjct: 1402 NSIISPNADYEYVWSLEDVFENEDVSSLK 1430


>SPAC2E12.03c |||G-protein coupled receptor |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 283

 Score = 26.6 bits (56), Expect = 3.6
 Identities = 12/29 (41%), Positives = 16/29 (55%)
 Frame = +3

Query: 396 LNAMLALVAPMSVKIFANWRVVFMYVVGT 482
           L AML L   + ++    W VVFM V+ T
Sbjct: 122 LQAMLILTIKLGIRRHVEWPVVFMGVLAT 150


>SPBC1198.06c |||mannan endo-1,6-alpha-mannosidase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 466

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 10/26 (38%), Positives = 13/26 (50%)
 Frame = +3

Query: 90  WDQVVETFDDMNLKEELLRGIYAYGF 167
           WD   E FDD N  +   +GI+   F
Sbjct: 286 WDPQCEYFDDCNSDQTAFKGIFMQSF 311


>SPAC27E2.07 |pvg2|mug53|galactose residue biosynthesis protein
           Pvg2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 389

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = -1

Query: 391 QVITKSYHHLLNLLGQLSCGSQDQ 320
           +++ KSYH+L N   QLS  ++DQ
Sbjct: 165 ELVDKSYHNLHNAWSQLSREAKDQ 188


>SPBC3F6.05 |rga1||GTPase activating protein
           Rga1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1150

 Score = 26.2 bits (55), Expect = 4.8
 Identities = 10/18 (55%), Positives = 13/18 (72%)
 Frame = +1

Query: 595 PDPLMVFKMVGQLIVSSQ 648
           PDPL+ FK+ G  I SS+
Sbjct: 928 PDPLLTFKLFGLFITSSK 945


>SPCC736.08 |cbf11||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 613

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +2

Query: 356 IQKVVIALGDHLNAKCHACIGGTNVRED 439
           ++ +  A+ DHL+   + CIG  N+ ED
Sbjct: 134 VEMIRRAISDHLDLLNNCCIGIANLNED 161


>SPBC25H2.03 |||vacuolar protein involved in phosphoinositide
           metabolism|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 811

 Score = 25.8 bits (54), Expect = 6.3
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%)
 Frame = -1

Query: 451 QLANIFTDIGAT---NASMAFSIQVITKSYHHLLNLL 350
           +L NIFT +      N+   FS+ +++++Y H  NLL
Sbjct: 598 KLQNIFTTLYTAWCHNSIAVFSLCLLSQNYEHAANLL 634


>SPCC1906.04 |wtf20||wtf element Wtf20|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 258

 Score = 25.4 bits (53), Expect = 8.3
 Identities = 9/19 (47%), Positives = 13/19 (68%)
 Frame = -2

Query: 651 ILT*NNQLTNHLEDHQWIW 595
           +L   N+L++HL D QW W
Sbjct: 175 LLKAENKLSSHLGDQQWGW 193


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,300,343
Number of Sequences: 5004
Number of extensions: 73267
Number of successful extensions: 285
Number of sequences better than 10.0: 32
Number of HSP's better than 10.0 without gapping: 237
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 283
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 341222980
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).