SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30047
         (794 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC3F10.05c |mug113||DUF1766 family protein|Schizosaccharomyces...    26   5.4  
SPBC1703.09 |||sequence orphan|Schizosaccharomyces pombe|chr 2||...    26   7.1  
SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces ...    25   9.4  

>SPAC3F10.05c |mug113||DUF1766 family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 326

 Score = 26.2 bits (55), Expect = 5.4
 Identities = 9/20 (45%), Positives = 13/20 (65%)
 Frame = +2

Query: 698 LPLRGMVVFQHW*NPFLKRK 757
           +P RG+VV + W NP L  +
Sbjct: 163 IPTRGVVVLEDWINPLLSER 182


>SPBC1703.09 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 202

 Score = 25.8 bits (54), Expect = 7.1
 Identities = 17/54 (31%), Positives = 27/54 (50%)
 Frame = -1

Query: 197 HSLIAAKSCALVLTSSFNSSRIFFHSSPEG*IRVAVDAISLLQYVTIQFGTSCF 36
           H  I A S  L+L   +  +R FF SS    IR++ + I LL   ++    +C+
Sbjct: 117 HLEITAMSEQLIL-QKYQKNRFFFMSSINALIRISRNCIKLLFKNSLVLLAACY 169


>SPCC1020.02 |spc7||kinetochore protein Spc7|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1364

 Score = 25.4 bits (53), Expect = 9.4
 Identities = 13/36 (36%), Positives = 19/36 (52%)
 Frame = +2

Query: 356 NQTRANGPAE*SPRTYTPWLDASRSTSNHRQSTGQE 463
           NQT+ + P + S  T     D S++  NH QS  +E
Sbjct: 295 NQTQLSSPNKSSSPTSIEISDFSKNNENHDQSENKE 330


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,490,838
Number of Sequences: 5004
Number of extensions: 77284
Number of successful extensions: 210
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 200
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 210
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 387388442
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).