SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30041
         (747 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC458.03 |||nuclear telomere cap complex subunit |Schizosaccha...    29   0.93 
SPBP23A10.14c |ell1||RNA polymerase II transcription elongation ...    26   5.0  
SPAC9.13c |cwf16|SPAPJ735.01c|splicing factor |Schizosaccharomyc...    26   5.0  

>SPAC458.03 |||nuclear telomere cap complex subunit
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 868

 Score = 28.7 bits (61), Expect = 0.93
 Identities = 13/37 (35%), Positives = 21/37 (56%)
 Frame = -1

Query: 669 QMAPFL*ILPSCHLVCGV*TCVNLFIKIKRIVQRILV 559
           QM   + +L +C  +CG   C NLF+    + Q+IL+
Sbjct: 574 QMTAIVELLLTCLDICGPVICTNLFVSDYSMRQKILI 610


>SPBP23A10.14c |ell1||RNA polymerase II transcription elongation
           factor SpELL|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 533

 Score = 26.2 bits (55), Expect = 5.0
 Identities = 14/39 (35%), Positives = 19/39 (48%)
 Frame = +2

Query: 617 TPHTRWQDGRIYKNGAIWRYTINKTRAYSLKFIKFYPIY 733
           +P    QD  I K     RYT  + RA + +F + YP Y
Sbjct: 444 SPKKNEQDAWIAKKRRQQRYTTEEMRALAKRFRETYPRY 482


>SPAC9.13c |cwf16|SPAPJ735.01c|splicing factor |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 270

 Score = 26.2 bits (55), Expect = 5.0
 Identities = 11/34 (32%), Positives = 18/34 (52%)
 Frame = -3

Query: 670 PDGAIFVNPSILPSCMRCVNVCEFIYKNKTYSSK 569
           P+G       + P  MRC    E+IYK K ++++
Sbjct: 31  PNGGKLTVRLMTPFSMRCHTCGEYIYKGKKFNAR 64


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,197,607
Number of Sequences: 5004
Number of extensions: 66466
Number of successful extensions: 126
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 125
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 126
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 355273338
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).