SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30038
         (661 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr 2||...   175   6e-45
SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex s...   102   5e-23
SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyce...   100   2e-22
SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces pomb...    98   1e-21
SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomy...    72   9e-14
SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces pombe...    63   3e-11
SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit Arp42|Sc...    58   1e-09
SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit Arp9|Schizosa...    44   1e-05
SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces po...    38   0.001
SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr...    37   0.003
SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce...    32   0.084
SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr 1...    29   0.45 
SPBC530.01 |gyp1||GTPase activating protein Gyp1 |Schizosaccharo...    27   3.2  
SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces pomb...    27   3.2  
SPCC1223.03c |gut2||glycerol-3-phosphate dehydrogenase Gut2|Schi...    26   4.2  
SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces p...    26   4.2  
SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr 2|||M...    26   4.2  
SPCP1E11.04c |pal1||membrane associated protein Pal1 |Schizosacc...    26   5.5  
SPBC23G7.08c |rga7||GTPase activating protein Rga7|Schizosacchar...    25   7.3  

>SPBC32H8.12c |act1|cps8|actin |Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 375

 Score =  175 bits (425), Expect = 6e-45
 Identities = 78/85 (91%), Positives = 81/85 (95%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           LKYPIEHGIV NWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPK+NREKMTQI+FET
Sbjct: 67  LKYPIEHGIVNNWDDMEKIWHHTFYNELRVAPEEHPCLLTEAPLNPKSNREKMTQIIFET 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           FN PA YVAIQAVLSLYASGRTTG+
Sbjct: 127 FNAPAFYVAIQAVLSLYASGRTTGI 151



 Score =  135 bits (327), Expect = 5e-33
 Identities = 61/69 (88%), Positives = 65/69 (94%)
 Frame = +1

Query: 61  DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 240
           +EE+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH G+MVGMGQKDSYVGDEAQSK
Sbjct: 2   EEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMVGMGQKDSYVGDEAQSK 61

Query: 241 RGILTSNTP 267
           RGILT   P
Sbjct: 62  RGILTLKYP 70



 Score = 95.1 bits (226), Expect = 8e-21
 Identities = 43/46 (93%), Positives = 45/46 (97%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VLDSGDGV+HTVPIYEGYALPHAI+RLDLAGRDLTDYLMKIL ERG
Sbjct: 152 VLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILMERG 197


>SPAC11H11.06 |arp2|SPAC22F8.01|ARP2/3 actin-organizing complex
           subunit Arp2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 390

 Score =  102 bits (244), Expect = 5e-23
 Identities = 42/85 (49%), Positives = 65/85 (76%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           +KYP+E+GI+ ++++M ++W +TF+ +L++ P    +LLTE P+NP ANREKM + MFE 
Sbjct: 67  VKYPMENGIIRDFEEMNQLWDYTFFEKLKIDPRGRKILLTEPPMNPVANREKMCETMFER 126

Query: 435 FNTPAMYVAIQAVLSLYASGRTTGM 509
           +    +YVAIQAVLSLYA G ++G+
Sbjct: 127 YGFGGVYVAIQAVLSLYAQGLSSGV 151



 Score = 61.3 bits (142), Expect = 1e-10
 Identities = 26/46 (56%), Positives = 34/46 (73%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           V+DSGDGV+H VP+YE   L H + RLD+AGRD T YL+ +L  +G
Sbjct: 152 VVDSGDGVTHIVPVYESVVLNHLVGRLDVAGRDATRYLISLLLRKG 197



 Score = 58.8 bits (136), Expect = 6e-10
 Identities = 32/69 (46%), Positives = 42/69 (60%), Gaps = 2/69 (2%)
 Frame = +1

Query: 67  EVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSK 240
           E A +V+DNG+G  K G+A D+ PR  FPSIVGRP  R +     +  KD  VGDEA++ 
Sbjct: 2   ESAPIVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDEAEAV 61

Query: 241 RGILTSNTP 267
           R +L    P
Sbjct: 62  RSLLQVKYP 70


>SPAC630.03 |arp3|act2|actin-like protein Arp3|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score =  100 bits (240), Expect = 2e-22
 Identities = 43/79 (54%), Positives = 54/79 (68%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFET 434
           L YPI HG + NWD ME+ W  + +  LR  PE+H  LLTE PLNP  NRE   +IMFE+
Sbjct: 90  LDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFES 149

Query: 435 FNTPAMYVAIQAVLSLYAS 491
           FN   +Y+A+QAVL+L AS
Sbjct: 150 FNCAGLYIAVQAVLALAAS 168



 Score = 53.2 bits (122), Expect = 3e-08
 Identities = 23/51 (45%), Positives = 35/51 (68%)
 Frame = +2

Query: 491 RSYHRYVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           RS    V+DSGDGV+H +P+ EGY +  +I  + LAGRD+T ++  +L +R
Sbjct: 177 RSLTGTVVDSGDGVTHIIPVAEGYVIGSSIKTMPLAGRDVTYFVQSLLRDR 227



 Score = 42.7 bits (96), Expect = 5e-05
 Identities = 20/52 (38%), Positives = 32/52 (61%), Gaps = 2/52 (3%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVG--MGQKDSYVGDE 228
           +++DNG+G  K G+AG+DAP  VFP+++   R  G   G  +  K SY+  +
Sbjct: 8   IIMDNGTGYSKLGYAGNDAPSYVFPTVIA-TRSAGASSGPAVSSKPSYMASK 58


>SPBC1347.12 |||actin-like protein Arp1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 379

 Score = 97.9 bits (233), Expect = 1e-21
 Identities = 43/86 (50%), Positives = 61/86 (70%), Gaps = 1/86 (1%)
 Frame = +3

Query: 255 LKYPIEHGIVTNWDDMEKIWHHTFYNE-LRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++ PIE GI+ NW DME+IW + + ++ L   PEEHP+LLTE PL    N+EK+ +  +E
Sbjct: 71  IQRPIERGIIQNWSDMEEIWSYIYSDQQLNTLPEEHPLLLTEPPLANIRNKEKIAEYFYE 130

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
           T N PA+  ++Q VL+LYAS RTTG+
Sbjct: 131 TLNVPALSFSLQPVLALYASARTTGI 156



 Score = 77.0 bits (181), Expect = 2e-15
 Identities = 34/63 (53%), Positives = 44/63 (69%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTS 258
           + +DNGSG  KAGFAGDD P+ +FP+ VGR +H+ VM    QKD +VG EAQ+ RG+L  
Sbjct: 12  ICIDNGSGFIKAGFAGDDIPKCLFPTCVGRIKHERVMPSSIQKDMFVGSEAQNLRGLLKI 71

Query: 259 NTP 267
             P
Sbjct: 72  QRP 74



 Score = 57.2 bits (132), Expect = 2e-09
 Identities = 23/46 (50%), Positives = 36/46 (78%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERG 646
           VL+ GDG++H+VPIY+G+++P AI + ++ GRD+TDYL   L + G
Sbjct: 157 VLECGDGLTHSVPIYDGFSIPSAIQQEEIGGRDVTDYLQLQLRKSG 202


>SPBP23A10.08 |alp5|arp4|actin-like protein Arp4|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 433

 Score = 71.7 bits (168), Expect = 9e-14
 Identities = 33/84 (39%), Positives = 48/84 (57%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++K  I +G V NWD    +W +    +L+  P EHP+L+TE   NP  NR K  + MFE
Sbjct: 64  EIKNAIRNGWVENWDVTVDLWRYGLEQQLKTNPLEHPILITEPFDNPPENRVKTLETMFE 123

Query: 432 TFNTPAMYVAIQAVLSLYASGRTT 503
           +   PA Y+A Q   + +ASG+ T
Sbjct: 124 SLRCPATYLAKQETCAAFASGKGT 147



 Score = 40.3 bits (90), Expect = 2e-04
 Identities = 16/34 (47%), Positives = 24/34 (70%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG 165
           +EV+A+V+D GS   + GF+G+D P+ V PS  G
Sbjct: 9   DEVSAIVIDPGSKWTRIGFSGEDIPKCVLPSYCG 42


>SPBC365.10 |||actin-like protein Arp5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 721

 Score = 63.3 bits (147), Expect = 3e-11
 Identities = 27/74 (36%), Positives = 44/74 (59%)
 Frame = +3

Query: 264 PIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNT 443
           P E  +++NWD ME++  +TF  +L +   EHP+ +TE   NP   R  MT+++FE +N 
Sbjct: 86  PFERNVISNWDLMEQVLDYTFL-KLGIDRMEHPICMTEPLANPTYVRSTMTELLFELYNA 144

Query: 444 PAMYVAIQAVLSLY 485
           P++   I  + S Y
Sbjct: 145 PSVAYGIDGLFSFY 158



 Score = 35.9 bits (79), Expect = 0.005
 Identities = 15/32 (46%), Positives = 22/32 (68%)
 Frame = +1

Query: 79  LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPR 174
           LV+DNGS   +AG+ G+  P+ VF ++V R R
Sbjct: 27  LVIDNGSWQLRAGWGGEKDPKLVFDNLVSRYR 58



 Score = 29.9 bits (64), Expect = 0.34
 Identities = 12/41 (29%), Positives = 21/41 (51%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKI 631
           VL+ G+  SH +P+  G  +     R+   G   + YL+K+
Sbjct: 169 VLNLGNAASHVIPVLNGERILSEAKRISWGGSQSSSYLLKL 209


>SPAC23D3.09 |arp42|arp4|SWI/SNF and RSC complex subunit
           Arp42|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 430

 Score = 57.6 bits (133), Expect = 1e-09
 Identities = 24/86 (27%), Positives = 49/86 (56%)
 Frame = +3

Query: 252 DLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFE 431
           ++K    +GI+ +W+     W      +L+V P E+ +++TE   NP++ R+++ +  FE
Sbjct: 67  EVKNGKSNGIIQDWESTLYTWERGLKEKLQVNPTEYAMMITEPSWNPQSVRQQIMEAAFE 126

Query: 432 TFNTPAMYVAIQAVLSLYASGRTTGM 509
             + PA Y+  QAV   +A+ ++T +
Sbjct: 127 QLHVPAFYLTKQAVCVAFANSKSTAL 152



 Score = 38.7 bits (86), Expect = 7e-04
 Identities = 20/57 (35%), Positives = 33/57 (57%)
 Frame = +1

Query: 64  EEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 234
           EE+ +LV+D GS   + G+AG+++P  + PS      + GV   +  ++ YV DE Q
Sbjct: 8   EEIPSLVIDPGSCWTRFGYAGEESPMTILPS------YYGVRSDVTGRNKYVVDELQ 58


>SPAC1071.06 |arp9||SWI/SNF and RSC complex subunit
           Arp9|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 523

 Score = 44.4 bits (100), Expect = 1e-05
 Identities = 27/91 (29%), Positives = 42/91 (46%), Gaps = 4/91 (4%)
 Frame = +3

Query: 249 PDLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE----HPVLLTEAPLNPKANREKMT 416
           P+   PI+ G V +W+ ++  W H  Y+ L   P +    +PV L         +RE  T
Sbjct: 108 PNEIQPIQRGRVVDWEALKAFWKH-LYSLLLKDPNDTTFRYPVCLVIPTYWSLYDRELAT 166

Query: 417 QIMFETFNTPAMYVAIQAVLSLYASGRTTGM 509
           Q  FE    P   +A + ++ LYA G   G+
Sbjct: 167 QFFFEECQVPGFTIAYEPLMGLYAIGILHGL 197


>SPCC550.12 |arp6||actin-like protein Arp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 401

 Score = 37.9 bits (84), Expect = 0.001
 Identities = 15/45 (33%), Positives = 29/45 (64%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTER 643
           V+DSG   +H +P+ +      A+ R+D+ G+ LT+YL ++++ R
Sbjct: 160 VIDSGYSFTHIIPVIDFSVQEQAVKRVDVGGKLLTNYLKEVISYR 204


>SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1517

 Score = 36.7 bits (81), Expect = 0.003
 Identities = 19/55 (34%), Positives = 29/55 (52%)
 Frame = +1

Query: 124 GDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTSNTPSNTESSL 288
           G+  PRA F  ++  P H G+++ M  KD   G+E  S +G  +  TP N  S +
Sbjct: 502 GNQNPRATFVPLLCLPEHGGMVISM--KDWIGGEEFMSPKGFKSPRTPENEISEV 554


>SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1666

 Score = 31.9 bits (69), Expect = 0.084
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 5/53 (9%)
 Frame = +3

Query: 324  FYNELRVAPEEHPVLLTE--APLNPKANREKMTQIMFETFNTPAM---YVAIQ 467
            +Y  L    E+HP+LLT+  A L P+ +  ++ +I  ++ NTP +    VAIQ
Sbjct: 1399 YYRALNFYLEQHPMLLTDLLAALTPRIDHPRVIRIFEKSENTPLILNFMVAIQ 1451


>SPAPB18E9.04c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 800

 Score = 29.5 bits (63), Expect = 0.45
 Identities = 19/55 (34%), Positives = 23/55 (41%), Gaps = 1/55 (1%)
 Frame = -3

Query: 221 PTYESFCPM-PTITP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAATSSS 60
           PT  S  P+ PT+ P     P    N     S P         PL+TTN  TS+S
Sbjct: 401 PTGNSTTPVTPTVPPTSSSTPLTTTNCTTSTSVPYTSTPVTSTPLATTNCTTSTS 455


>SPBC530.01 |gyp1||GTPase activating protein Gyp1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 514

 Score = 26.6 bits (56), Expect = 3.2
 Identities = 19/85 (22%), Positives = 40/85 (47%)
 Frame = -1

Query: 628 LHEVVCEVATGQVQTQDGVRECVSLVDGYGVGDTVAGVQHIPVVRPDAYSESTAWMATYM 449
           L +++  +    +  Q G+R  V+ +    +      V+H+ +   D    S  WM   +
Sbjct: 364 LSKLLDGIQDNYIHAQPGIRRQVNNLRELTLRIDEPLVKHLQMEGVDFLQFSFRWMNCLL 423

Query: 448 AGVLNVSNMIWVIFSLLALGLRGAS 374
              L++SN+I +  + +A G++G S
Sbjct: 424 MRELSISNIIRMWDTYMAEGVQGFS 448


>SPAC664.02c |||actin-like protein Arp8 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 620

 Score = 26.6 bits (56), Expect = 3.2
 Identities = 12/42 (28%), Positives = 24/42 (57%)
 Frame = +2

Query: 509 VLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKIL 634
           V+D G   +    + EG  +P++ ++++  G D+T   MK+L
Sbjct: 295 VVDMGAQKTSISCVEEGVVVPNSRIKINYGGDDITLLFMKLL 336


>SPCC1223.03c |gut2||glycerol-3-phosphate dehydrogenase
           Gut2|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 649

 Score = 26.2 bits (55), Expect = 4.2
 Identities = 20/71 (28%), Positives = 31/71 (43%)
 Frame = +3

Query: 369 LTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGMCWTPATVSPTPYP 548
           L+  P NP  + + +  I+ E        V  + VLS +   R   +   P+TV P   P
Sbjct: 361 LSSVPTNPTPSEDDIQLILKELQKYLVFPVDREDVLSAWCGIRP--LVRDPSTVPPGTDP 418

Query: 549 STRDTHSLTPS 581
           +T +T  L  S
Sbjct: 419 TTGETQGLVRS 429


>SPBC115.01c |rrp46||exosome subunit Rrp46 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 226

 Score = 26.2 bits (55), Expect = 4.2
 Identities = 10/25 (40%), Positives = 18/25 (72%)
 Frame = +3

Query: 366 LLTEAPLNPKANREKMTQIMFETFN 440
           +L  APL+ +   +KM +++FET+N
Sbjct: 181 VLETAPLHAEEVSKKMKELLFETYN 205


>SPBC13E7.09 |vrp1||verprolin|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 309

 Score = 26.2 bits (55), Expect = 4.2
 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 2/41 (4%)
 Frame = -3

Query: 224 SPTYESFC--PMPTITP*WRGLPTIEGNTARGASSPAKPAL 108
           S T +SF   P+PT  P    LPT   NT +    P+ PAL
Sbjct: 64  SNTPKSFAAPPVPTGAP---SLPTSSNNTQQAEERPSMPAL 101


>SPCP1E11.04c |pal1||membrane associated protein Pal1
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 425

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 10/18 (55%), Positives = 12/18 (66%)
 Frame = -1

Query: 118 NRPCTYRSHCLLPTRQLP 65
           NRP  YRSH  + TR+ P
Sbjct: 323 NRPSNYRSHSSMGTRRSP 340


>SPBC23G7.08c |rga7||GTPase activating protein
           Rga7|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 695

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 20/64 (31%), Positives = 33/64 (51%), Gaps = 1/64 (1%)
 Frame = -3

Query: 248 IPLLLCASSPTYESFCPMPTI-TP*WRGLPTIEGNTARGASSPAKPALHIPEPLSTTNAA 72
           IP  L  ++P   +F P P++ +P +    T   +TA  ++SP    L  P   + TN +
Sbjct: 363 IPSPLQNTNPAPSTF-PNPSVASPAFPNSSTSNPSTAPASASPLASTLK-PSTANDTNGS 420

Query: 71  TSSS 60
           +SSS
Sbjct: 421 SSSS 424


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,968,301
Number of Sequences: 5004
Number of extensions: 67176
Number of successful extensions: 228
Number of sequences better than 10.0: 19
Number of HSP's better than 10.0 without gapping: 196
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 224
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 299817502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).