SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30036
         (699 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC13G6.02c |rps101|rps1-1, rps3a-1|40S ribosomal protein S3a|S...   116   4e-27
SPAC22H12.04c |rps102|rps1-2, rps3a-2|40S ribosomal protein S3a|...   113   3e-26
SPBC32H8.13c |mok12||alpha-1,3-glucan synthase Mok12|Schizosacch...    27   2.6  
SPAC343.04c |gnr1||heterotrimeric G protein beta subunit Gnr1|Sc...    27   3.4  
SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr 3|||...    27   3.4  
SPBC337.13c |gtr1||Gtr1/RagA G protein Gtr1|Schizosaccharomyces ...    26   6.0  
SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharo...    26   6.0  
SPAC19E9.02 |fin1||serine/threonine protein kinase Fin1|Schizosa...    26   6.0  
SPBC1921.05 |ape2||aminopeptidase Ape2|Schizosaccharomyces pombe...    25   7.9  
SPAC7D4.06c |alg3||dolichol-P-Man dependent alpha|Schizosaccharo...    25   7.9  
SPAC664.08c |||traub transciption factor family protein |Schizos...    25   7.9  

>SPAC13G6.02c |rps101|rps1-1, rps3a-1|40S ribosomal protein
           S3a|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 252

 Score =  116 bits (278), Expect = 4e-27
 Identities = 53/86 (61%), Positives = 66/86 (76%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG+KK++VDPF+RKDWYD+KAP+ F  + VG TLVNRT G K A++ LKGR+ EVSLAD
Sbjct: 13  KKGIKKRVVDPFSRKDWYDIKAPAFFEVKNVGKTLVNRTAGLKNANDSLKGRILEVSLAD 72

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ   D E SFRK +L  E +QG+ C
Sbjct: 73  LQ--KDEEHSFRKVKLRVEDIQGKSC 96



 Score = 97.5 bits (232), Expect = 2e-21
 Identities = 46/103 (44%), Positives = 66/103 (64%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L +F+G D+T+DKLR +V+KWQ+ IEAN  +KTTDGY+ R+F IGFT++     +KT YA
Sbjct: 97  LTSFNGFDMTSDKLRSLVRKWQSTIEANQTIKTTDGYLCRIFVIGFTSRRVNQVKKTTYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           Q +Q+RAI +KM ++I                 P+ I + IEK
Sbjct: 157 QSSQIRAIHQKMFQVIQNQANGCSMKELVQKLIPEVIGRAIEK 199



 Score = 25.8 bits (54), Expect = 6.0
 Identities = 13/26 (50%), Positives = 19/26 (73%)
 Frame = +3

Query: 585 YPLRDVWHPKVKVLKRAPFSEISKLI 662
           YPL++V+  KVK+LK AP  +  KL+
Sbjct: 205 YPLQNVFVRKVKILK-APKHDAQKLL 229


>SPAC22H12.04c |rps102|rps1-2, rps3a-2|40S ribosomal protein
           S3a|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 252

 Score =  113 bits (271), Expect = 3e-26
 Identities = 51/86 (59%), Positives = 66/86 (76%)
 Frame = +2

Query: 2   KKGVKKKIVDPFTRKDWYDVKAPSMFSKRQVGTTLVNRTQGTKIASEGLKGRVFEVSLAD 181
           KKG+KK++VDPF+RK+WYD+KAP+ F  + VG TLVNRT G K A++ LKGR+ EVSLAD
Sbjct: 13  KKGIKKRVVDPFSRKEWYDIKAPAFFEVKNVGKTLVNRTAGLKNANDSLKGRILEVSLAD 72

Query: 182 LQADTDAERSFRKFRLIAEYVQGRMC 259
           LQ   D E +FRK +L  E +QG+ C
Sbjct: 73  LQ--KDEEHAFRKVKLRVEDIQGKSC 96



 Score =   99 bits (238), Expect = 3e-22
 Identities = 46/103 (44%), Positives = 70/103 (67%)
 Frame = +1

Query: 259 LCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           L +F+G+ +T+DKLR +V+KWQT IEA+  +KTTDGY+ RVF IGFT + +   +KT YA
Sbjct: 97  LTSFNGLSITSDKLRSLVRKWQTTIEADQTIKTTDGYLCRVFVIGFTRRRANQVKKTTYA 156

Query: 439 QHTQVRAIRKKMCEIITRDVTNSDSGRW*TS*FPDSIAKDIEK 567
           Q +Q+RAIR+KM ++I    ++           P+ I ++IE+
Sbjct: 157 QSSQIRAIRQKMFQVIQNQTSSCSMRELVQKLIPEVIGREIER 199


>SPBC32H8.13c |mok12||alpha-1,3-glucan synthase
            Mok12|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2352

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 10/22 (45%), Positives = 17/22 (77%)
 Frame = -2

Query: 569  PFSMSLAMESGNQLVHHLPESE 504
            PFS+ L +++ ++L+  LPESE
Sbjct: 1146 PFSVHLPLDNSSELLKQLPESE 1167


>SPAC343.04c |gnr1||heterotrimeric G protein beta subunit
           Gnr1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 507

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 14/44 (31%), Positives = 23/44 (52%)
 Frame = +1

Query: 238 ICARTYVLCNFHGMDLTTDKLRWMVKKWQTLIEANIDVKTTDGY 369
           IC   YVL NF   D   +K R +    ++  ++N ++ T +GY
Sbjct: 95  ICEAIYVLQNFESTDFNKEKERLVSIILESNNKSNNELITKNGY 138


>SPCC895.05 |for3||formin For3|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1461

 Score = 26.6 bits (56), Expect = 3.4
 Identities = 14/32 (43%), Positives = 20/32 (62%), Gaps = 1/32 (3%)
 Frame = -1

Query: 699 PPCLHRLR-RESSQSTSRSPKTGPSSTLSLSD 607
           PP    ++ R SS STS + + G  ST+SLS+
Sbjct: 10  PPTSRSIQSRNSSYSTSSNERIGTPSTISLSE 41


>SPBC337.13c |gtr1||Gtr1/RagA G protein Gtr1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 308

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 14/37 (37%), Positives = 22/37 (59%), Gaps = 2/37 (5%)
 Frame = +1

Query: 256 VLCNFHGMDLTTDKLRWMV--KKWQTLIEANIDVKTT 360
           V C  H MDL  + LR +V  ++   L+E + D++TT
Sbjct: 117 VFCLIHKMDLVQEDLRDLVFEERKAILLETSKDLETT 153


>SPBC12C2.02c |ste20|ste16|sterility protein Ste20|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1309

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 12/33 (36%), Positives = 18/33 (54%), Gaps = 2/33 (6%)
 Frame = +3

Query: 384  LHWFHQ*GLLEPTQDVLRPAHSGQ--SNQKENV 476
            LHW+    L+  +Q +  P H+GQ  S  + NV
Sbjct: 1162 LHWYSLMSLMGTSQGICIPRHAGQVLSTPRRNV 1194


>SPAC19E9.02 |fin1||serine/threonine protein kinase
           Fin1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 722

 Score = 25.8 bits (54), Expect = 6.0
 Identities = 12/42 (28%), Positives = 20/42 (47%)
 Frame = -1

Query: 279 HAVEVAEHIRPCTYSAINLNLRKDLSASVSACRSARETSKTL 154
           H +EV   +RP TY  +   +  D+ + + + R   E S  L
Sbjct: 260 HCLEVNSDLRPTTYQLLRSPILSDIRSKLESERVVLEQSDLL 301


>SPBC1921.05 |ape2||aminopeptidase Ape2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 882

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 12/46 (26%), Positives = 21/46 (45%)
 Frame = +1

Query: 301 RWMVKKWQTLIEANIDVKTTDGYVLRVFCIGFTNKDSLSQRKTCYA 438
           ++    W  L+       T  GYV+R    GFT+  ++ + K  +A
Sbjct: 795 KFATSNWDKLLSRLPVAGTMRGYVVRFVTSGFTHASAIDKIKEFFA 840


>SPAC7D4.06c |alg3||dolichol-P-Man dependent
           alpha|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 406

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 15/64 (23%), Positives = 29/64 (45%), Gaps = 4/64 (6%)
 Frame = -2

Query: 512 ESELVTSRVMISHIFFLIALT*VCW----A*HVLRWLKESLLVKPMQKTRRTYPSVVFTS 345
           ES   ++ ++  H+  L+A T   W           +   L +KP+ K +   P+ +FT+
Sbjct: 263 ESTSFSTSILFLHVALLVAFTCKHWNKLSRATPFAMVNSMLTLKPLPKLQLATPNFIFTA 322

Query: 344 MLAS 333
           +  S
Sbjct: 323 LATS 326


>SPAC664.08c |||traub transciption factor family protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 452

 Score = 25.4 bits (53), Expect = 7.9
 Identities = 13/34 (38%), Positives = 18/34 (52%), Gaps = 1/34 (2%)
 Frame = +1

Query: 280 DLTTD-KLRWMVKKWQTLIEANIDVKTTDGYVLR 378
           D T D  +RWM  K Q   + N+D K + G  +R
Sbjct: 351 DSTRDGTVRWMATKKQKQKKENVDTKASKGRKIR 384


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,011,033
Number of Sequences: 5004
Number of extensions: 64463
Number of successful extensions: 216
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 202
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 214
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 323158234
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).