SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30031
         (567 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces...    27   2.5  
SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyce...    26   3.4  
SPBC25H2.12c |cct7||chaperonin-containing T-complex eta subunit ...    26   4.4  
SPAC4A8.10 |||lipase |Schizosaccharomyces pombe|chr 1|||Manual         26   4.4  
SPCC1919.04 |||sequence orphan|Schizosaccharomyces pombe|chr 3||...    25   5.9  
SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomy...    25   5.9  

>SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 3699

 Score = 26.6 bits (56), Expect = 2.5
 Identities = 11/26 (42%), Positives = 17/26 (65%), Gaps = 1/26 (3%)
 Frame = -2

Query: 311  WDEHHNLHIEAGLHDVL-ARFMVMHE 237
            +D HH L I+  LHD+L A F ++ +
Sbjct: 1182 YDSHHKLWIQDRLHDILKALFFILKD 1207


>SPAC26A3.05 |chc1||clathrin heavy chain Chc1 |Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 1666

 Score = 26.2 bits (55), Expect = 3.4
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = -2

Query: 338  LRFCIQMHIWDEHHNLHIEAGLHDVLARFMV 246
            +R C QMH+W+E   L++    +D  A  M+
Sbjct: 1345 IRACDQMHLWNEAVFLYVHDQSYDNAAAVMM 1375


>SPBC25H2.12c |cct7||chaperonin-containing T-complex eta subunit
           Cct7|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 558

 Score = 25.8 bits (54), Expect = 4.4
 Identities = 11/29 (37%), Positives = 16/29 (55%)
 Frame = -1

Query: 267 CTGAFHGDARARVQRV*SELHDALLLVQH 181
           CT    G A   +  V   LHDA+++V+H
Sbjct: 375 CTLILRGGADQFIAEVERSLHDAIMIVKH 403


>SPAC4A8.10 |||lipase |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 723

 Score = 25.8 bits (54), Expect = 4.4
 Identities = 20/77 (25%), Positives = 33/77 (42%), Gaps = 6/77 (7%)
 Frame = +3

Query: 114 VSSQSIIRHDVTHGHGNEGQSYHVVPVAAHHGAPTIHAAPVLVHHHETRQ------YIME 275
           ++SQ+I +    +      QS H +   +     T+HA P L   H+T +      Y   
Sbjct: 179 IASQAIFKDRSINFELAISQSQHSIRAMSAADIDTLHAFPALHVEHQTPENLWRLPYSSF 238

Query: 276 TSLNMKIMMLIPNMHLN 326
            S N  +++L   MH N
Sbjct: 239 HSKNSHLVVLTHGMHSN 255


>SPCC1919.04 |||sequence orphan|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 256

 Score = 25.4 bits (53), Expect = 5.9
 Identities = 18/48 (37%), Positives = 27/48 (56%), Gaps = 2/48 (4%)
 Frame = -3

Query: 397 LHDITVASLVLALQVPSVRVFDFVFKCIFGM--SIIIFILRLVSMMYW 260
           L  I   S V++  V S++VF  V    F    +++IFILR+VS+  W
Sbjct: 31  LSTILYVSAVISWNV-SLKVFGNVLLPGFLTIRTVVIFILRIVSLFLW 77


>SPAC26A3.12c |dhp1||5'-3' exoribonuclease Dhp1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 991

 Score = 25.4 bits (53), Expect = 5.9
 Identities = 7/16 (43%), Positives = 11/16 (68%)
 Frame = +2

Query: 113 CFIPVYY*TRCDSWSW 160
           C++ +YY   C SW+W
Sbjct: 622 CWVLLYYYQGCPSWTW 637


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,254,735
Number of Sequences: 5004
Number of extensions: 44696
Number of successful extensions: 123
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 121
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 123
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 240047038
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).