SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30029
         (530 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|c...    30   0.19 
SPBC119.01 |rpn3|SPBPJ4664.07|19S proteasome regulatory subunit ...    27   2.3  
SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, wit...    25   5.3  
SPCC663.05c |cia1||histone chaperone Cia1|Schizosaccharomyces po...    25   5.3  
SPAC1952.10c |||conserved fungal protein |Schizosaccharomyces po...    25   7.0  
SPBC29B5.02c |isp4||OPT oligopeptide transporter family |Schizos...    25   7.0  
SPAC144.06 |apl5||AP-3 adaptor complex subunit Apl5 |Schizosacch...    25   7.0  
SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C |Schizosaccharom...    25   9.3  
SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomy...    25   9.3  

>SPAC24H6.13 |||DUF221 family protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 871

 Score = 30.3 bits (65), Expect = 0.19
 Identities = 19/48 (39%), Positives = 25/48 (52%)
 Frame = +3

Query: 24  KRSKRSNSIQNRVNFYANESVKKTRTKRTVYGQPGPSTCAYIAGSKQR 167
           KRS   N  ++ +N   N+SVKK   K     +P PST  Y A  K+R
Sbjct: 227 KRSDLGNKYESTLNSLINKSVKK-HNKLVKKHKPLPSTLDYTAYVKKR 273


>SPBC119.01 |rpn3|SPBPJ4664.07|19S proteasome regulatory subunit
           Rpn3|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 497

 Score = 26.6 bits (56), Expect = 2.3
 Identities = 17/59 (28%), Positives = 30/59 (50%), Gaps = 2/59 (3%)
 Frame = +3

Query: 24  KRSKRSNSIQNRVNFYANESVKKTRTK--RTVYGQPGPSTCAYIAGSKQRDIKLYFTSL 194
           +R  + +S+    N  + E+ + T T+  RTV      +  A +  +KQRD +L + SL
Sbjct: 5   QRDMQVDSVNQEENVDSGETKQNTVTEVPRTVLQDVEANIAALMQATKQRDPRLVYRSL 63


>SPAC25G10.09c ||SPAC27F1.01c|actin cortical patch component, with EF
            hand and WH2 motif |Schizosaccharomyces pombe|chr
            1|||Manual
          Length = 1794

 Score = 25.4 bits (53), Expect = 5.3
 Identities = 12/38 (31%), Positives = 20/38 (52%)
 Frame = +3

Query: 63   NFYANESVKKTRTKRTVYGQPGPSTCAYIAGSKQRDIK 176
            +FY N S + T    T+Y        AY++ +++RD K
Sbjct: 944  SFYDNPS-ETTEKDATLYRHNDSDASAYVSSARRRDFK 980


>SPCC663.05c |cia1||histone chaperone Cia1|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 262

 Score = 25.4 bits (53), Expect = 5.3
 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 1/34 (2%)
 Frame = +1

Query: 25  NAANVPTPYKIELTFTLTRALKK-LALSALYTGS 123
           N A    PYK E+TF     LK  L     Y GS
Sbjct: 14  NPAKFSDPYKFEITFECLEPLKSDLEWKLTYVGS 47


>SPAC1952.10c |||conserved fungal protein |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 361

 Score = 25.0 bits (52), Expect = 7.0
 Identities = 12/31 (38%), Positives = 19/31 (61%)
 Frame = +2

Query: 293 RLYPVFKRIFMTVFFNSVHFCACATINWP*F 385
           R Y V+K IFM++  +  +FC  AT+ +  F
Sbjct: 200 RRYLVYK-IFMSLIKSDYYFCLTATVQYAIF 229


>SPBC29B5.02c |isp4||OPT oligopeptide transporter family
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 785

 Score = 25.0 bits (52), Expect = 7.0
 Identities = 12/38 (31%), Positives = 20/38 (52%), Gaps = 2/38 (5%)
 Frame = -2

Query: 382 LWPIDSCTCTKVYRIKKYRHKNSFKNG--IQA*RYFGY 275
           LWP++   CT +  + +   +N+  NG  I   R+F Y
Sbjct: 230 LWPVNLVQCTLIKTLHRKDLRNAVANGWRISPFRFFLY 267


>SPAC144.06 |apl5||AP-3 adaptor complex subunit Apl5
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 834

 Score = 25.0 bits (52), Expect = 7.0
 Identities = 10/19 (52%), Positives = 13/19 (68%)
 Frame = +3

Query: 267 CTLYPKYLYACIPFLKEFL 323
           C  YP+ + ACIP L+E L
Sbjct: 163 CLQYPEAISACIPKLRERL 181


>SPBC12D12.04c |pck2|sts6, pkc1|protein kinase C
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1016

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 9/23 (39%), Positives = 13/23 (56%)
 Frame = +3

Query: 234 LQSINTHYVAYCTLYPKYLYACI 302
           +Q I+ HY  +   YPK +  CI
Sbjct: 432 MQCIDCHYTCHKKCYPKVVTKCI 454


>SPAC23G3.02c |sib1||ferrichrome synthetase Sib1|Schizosaccharomyces
            pombe|chr 1|||Manual
          Length = 4924

 Score = 24.6 bits (51), Expect = 9.3
 Identities = 9/22 (40%), Positives = 14/22 (63%)
 Frame = +3

Query: 222  RVFFLQSINTHYVAYCTLYPKY 287
            ++FFLQ  N +YV +C  +  Y
Sbjct: 1432 QIFFLQGENKNYVLFCIHHVLY 1453


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,148,746
Number of Sequences: 5004
Number of extensions: 44153
Number of successful extensions: 119
Number of sequences better than 10.0: 9
Number of HSP's better than 10.0 without gapping: 115
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 119
length of database: 2,362,478
effective HSP length: 68
effective length of database: 2,022,206
effective search space used: 218398248
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).