SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30027
         (765 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC1006.07 |||translation initiation factor eIF4A|Schizosacchar...   194   2e-50
SPAC1F5.10 |||ATP-dependent RNA helicase, eIF4A related|Schizosa...   171   9e-44
SPBC776.09 |ste13||ATP-dependent RNA helicase Ste13|Schizosaccha...    97   2e-21
SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8 |Schizosaccha...    66   5e-12
SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyc...    66   5e-12
SPAC17G6.14c |uap56||ATP-dependent RNA helicase Uap56|Schizosacc...    61   2e-10
SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomy...    59   6e-10
SPCC63.11 |prp28||U5 snRNP-associated protein Prp28 |Schizosacch...    59   8e-10
SPBC4F6.07c |||ATP-dependent RNA helicase Mak5 |Schizosaccharomy...    58   2e-09
SPAC30D11.03 |drs1||ATP-dependent RNA helicase Drs1 |Schizosacch...    56   6e-09
SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10 |Schizosac...    53   4e-08
SPBC21H7.04 |||ATP-dependent RNA helicase Dbp7 |Schizosaccharomy...    51   2e-07
SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase Su...    51   2e-07
SPBP8B7.16c |dbp2||ATP-dependent RNA helicase Dbp2|Schizosacchar...    51   2e-07
SPCC10H11.01 |prp11||ATP-dependent RNA helicase Prp11|Schizosacc...    48   1e-06
SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3 |Schizosaccha...    48   1e-06
SPAC22F3.08c |rok1||ATP-dependent RNA helicase Rok1 |Schizosacch...    48   1e-06
SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomy...    48   1e-06
SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomy...    47   3e-06
SPCC1494.06c |||ATP-dependent RNA helicase Dbp9 |Schizosaccharom...    45   1e-05
SPCC285.03 |||ATP-dependent RNA helicase Dbp6|Schizosaccharomyce...    40   5e-04
SPBC691.04 |||mitochondrial ATP-dependent RNA helicase Mss116 |S...    38   0.002
SPBC24C6.02 |||ATP-dependent RNA helicase Spb4 |Schizosaccharomy...    37   0.003
SPAPJ696.01c |vps17||retromer complex subunit Vps17|Schizosaccha...    27   2.9  
SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|...    26   5.1  
SPAC27E2.07 |pvg2|mug53|galactose residue biosynthesis protein P...    26   5.1  
SPBC428.04 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||...    26   5.1  
SPAC27E2.10c |rfc3|SPAPJ698.01c|DNA replication factor C complex...    26   5.1  
SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S...    26   6.8  
SPCC736.08 |cbf11||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual    26   6.8  
SPAC4H3.13 |||transcription factor Pcc1 |Schizosaccharomyces pom...    26   6.8  
SPBC25H2.03 |||vacuolar protein involved in phosphoinositide met...    26   6.8  
SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces p...    25   9.0  
SPBC947.06c |||spermidine family transporter |Schizosaccharomyce...    25   9.0  

>SPAC1006.07 |||translation initiation factor
           eIF4A|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 392

 Score =  194 bits (472), Expect = 2e-50
 Identities = 106/207 (51%), Positives = 142/207 (68%), Gaps = 4/207 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSIS+LQ+IDTS+++CQALILAPTRELAQQIQKVV+ALGD +N +CHACIGGT V
Sbjct: 68  GKTATFSISVLQKIDTSLKQCQALILAPTRELAQQIQKVVVALGDLMNVECHACIGGTLV 127

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
           R+D+  L++GVHVVVGTPGRV+DMI   R +PT +  +F++   +    +SR        
Sbjct: 128 RDDMAALQAGVHVVVGTPGRVHDMIQR-RALPTDAVQMFVLD--EADEMLSRGFKDQIYD 184

Query: 361 FCQLMFKSYYSLLPCLMMYWKYLDAL*EIL---YAYLYRRKSLPWKVLNNF-TCIELEEW 528
             QL+  +   +L    M    L+   + +      L ++  L  + +  F   +E EEW
Sbjct: 185 IFQLLPPTAQVVLLSATMPQDVLEVTTKFMRDPIRILVKKDELTLEGIKQFYVAVEKEEW 244

Query: 529 KLETLCDLYDTLSIAQAVIFCNTRRKV 609
           KL+TLCDLY+T+++ QAVIFCNTRRKV
Sbjct: 245 KLDTLCDLYETVTVTQAVIFCNTRRKV 271



 Score =  130 bits (313), Expect = 3e-31
 Identities = 60/84 (71%), Positives = 74/84 (88%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RRAL  + +++FVLDEADEMLSRGFKDQI+D+F++L    QV+LLSATMP DVLEV+  F
Sbjct: 154 RRALPTDAVQMFVLDEADEMLSRGFKDQIYDIFQLLPPTAQVVLLSATMPQDVLEVTTKF 213

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
           MRDP+RILV+K+ELTLEGIKQFY+
Sbjct: 214 MRDPIRILVKKDELTLEGIKQFYV 237



 Score = 35.5 bits (78), Expect = 0.008
 Identities = 14/19 (73%), Positives = 16/19 (84%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE +  RDFTVS+MHG
Sbjct: 272 DWLTEQLTERDFTVSSMHG 290


>SPAC1F5.10 |||ATP-dependent RNA helicase, eIF4A
           related|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 394

 Score =  171 bits (416), Expect = 9e-44
 Identities = 102/208 (49%), Positives = 127/208 (61%), Gaps = 5/208 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTATFSI ILQ ID S+R+ QALIL+PTRELA QIQ VV+ALGDH+N +CHACIGGT+V
Sbjct: 70  GKTATFSIGILQSIDLSVRDTQALILSPTRELAVQIQNVVLALGDHMNVQCHACIGGTSV 129

Query: 181 REDIRQLESGVHVVVGTPGRVYDMILVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSSR 360
             DI++L+ G HVV GTPGRV DMI            L L +  +   +  + +     R
Sbjct: 130 GNDIKKLDYGQHVVSGTPGRVTDMIRRRNLRTRNVKMLILDEADELLNQGFKEQIYDIYR 189

Query: 361 F----CQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNN-FTCIELEE 525
           +     Q++  S       L M  K+      I    L +R  L  + L   F  +E EE
Sbjct: 190 YLPPGTQVVVVSATLPQDVLEMTNKFTTNPVRI----LVKRDELTLEGLKQYFIAVEKEE 245

Query: 526 WKLETLCDLYDTLSIAQAVIFCNTRRKV 609
           WK +TLCDLYDTL+I QAVIFCN+RRKV
Sbjct: 246 WKFDTLCDLYDTLTITQAVIFCNSRRKV 273



 Score =  103 bits (247), Expect = 3e-23
 Identities = 43/84 (51%), Positives = 68/84 (80%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           RR L    +K+ +LDEADE+L++GFK+QI+D+++ L    QV+++SAT+P DVLE++  F
Sbjct: 156 RRNLRTRNVKMLILDEADELLNQGFKEQIYDIYRYLPPGTQVVVVSATLPQDVLEMTNKF 215

Query: 438 MRDPVRILVQKEELTLEGIKQFYM 509
             +PVRILV+++ELTLEG+KQ+++
Sbjct: 216 TTNPVRILVKRDELTLEGLKQYFI 239



 Score = 31.9 bits (69), Expect = 0.10
 Identities = 12/19 (63%), Positives = 15/19 (78%)
 Frame = +2

Query: 611 DWLTESMHLRDFTVSAMHG 667
           DWLTE M   +FTV++MHG
Sbjct: 274 DWLTEKMREANFTVTSMHG 292


>SPBC776.09 |ste13||ATP-dependent RNA helicase
           Ste13|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 485

 Score = 97.1 bits (231), Expect = 2e-21
 Identities = 70/206 (33%), Positives = 100/206 (48%), Gaps = 1/206 (0%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F I  L+++DT   + Q LIL PTRELA Q  +V   LG H+N K     GGT +
Sbjct: 93  GKTAAFVIPSLEKVDTKKSKIQTLILVPTRELALQTSQVCKTLGKHMNVKVMVTTGGTTL 152

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI-LVVRFMPTPSNFLFLMKLMKCCPEVSRTRSMMSS 357
           R+DI +L   VH+VVGTPGRV D+    V      + F+         PE +     + S
Sbjct: 153 RDDIIRLNDTVHIVVGTPGRVLDLAGKGVADFSECTTFVMDEADKLLSPEFTPIIEQLLS 212

Query: 358 RFCQLMFKSYYSLLPCLMMYWKYLDAL*EILYAYLYRRKSLPWKVLNNFTCIELEEWKLE 537
            F +    S YS    L++   ++D      Y  +     L  + +  +     E  K+ 
Sbjct: 213 YFPKNRQISLYSATFPLIVK-NFMDKHLNKPYE-INLMDELTLRGVTQYYAFVDESQKVH 270

Query: 538 TLCDLYDTLSIAQAVIFCNTRRKVGL 615
            L  L+  L I Q++IFCN+  +V L
Sbjct: 271 CLNTLFSKLQINQSIIFCNSTNRVEL 296



 Score = 43.6 bits (98), Expect = 3e-05
 Identities = 26/72 (36%), Positives = 37/72 (51%)
 Frame = +3

Query: 291 FVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQK 470
           FV+DEAD++LS  F   I  +      + Q+ L SAT P  V       +  P  I +  
Sbjct: 190 FVMDEADKLLSPEFTPIIEQLLSYFPKNRQISLYSATFPLIVKNFMDKHLNKPYEINLM- 248

Query: 471 EELTLEGIKQFY 506
           +ELTL G+ Q+Y
Sbjct: 249 DELTLRGVTQYY 260


>SPBC543.06c |dbp8||ATP-dependent RNA helicase Dbp8
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 453

 Score = 66.1 bits (154), Expect = 5e-12
 Identities = 37/85 (43%), Positives = 49/85 (57%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ I+++         ALIL PTRELA QI +   ALG +LN K    +GG ++
Sbjct: 56  GKTAAFALPIIEKWSKDPSGIFALILTPTRELAIQIDEQFAALGANLNLKHALIVGGMDM 115

Query: 181 REDIRQLESGVHVVVGTPGRVYDMI 255
                 L    HVVV TPGR+ D+I
Sbjct: 116 IRQSIDLSKRPHVVVATPGRLADLI 140



 Score = 41.9 bits (94), Expect = 1e-04
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 2/50 (4%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKIL--SADVQVILLSATMPDDVLEV 425
           IK  V+DEAD +LS  F D + D F +L  S D Q +L +AT+ D + ++
Sbjct: 154 IKFLVMDEADRLLSPTFADDLDDCFSVLPASEDRQTLLFTATVTDAIRQL 203


>SPBC12C2.06 |||ATP-dependent RNA helicase Dbp5|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 503

 Score = 66.1 bits (154), Expect = 5e-12
 Identities = 37/85 (43%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSR-GFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRC 434
           RR L A  IK+FVLDEAD ML + G  DQ   +  +L  + Q++L SAT  + V + +  
Sbjct: 247 RRQLDARDIKVFVLDEADNMLDQQGLGDQSMRIKHLLPRNTQIVLFSATFSERVEKYAER 306

Query: 435 FMRDPVRILVQKEELTLEGIKQFYM 509
           F  +   I ++ EEL++EGIKQ YM
Sbjct: 307 FAPNANEIRLKTEELSVEGIKQLYM 331



 Score = 60.1 bits (139), Expect = 3e-10
 Identities = 30/86 (34%), Positives = 53/86 (61%), Gaps = 1/86 (1%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++++L ++D S+ + QA+ LAP+RELA+QI  VV  +G +   K         +
Sbjct: 165 GKTAAFALTMLSRVDASVPKPQAICLAPSRELARQIMDVVTEMGKYTEVKT-----AFGI 219

Query: 181 REDI-RQLESGVHVVVGTPGRVYDMI 255
           ++ + +  +    +V+GTPG V D++
Sbjct: 220 KDSVPKGAKIDAQIVIGTPGTVMDLM 245



 Score = 29.9 bits (64), Expect = 0.42
 Identities = 12/27 (44%), Positives = 17/27 (62%)
 Frame = +1

Query: 520 EEWKLETLCDLYDTLSIAQAVIFCNTR 600
           EE K   L +LY  L+I Q++IFC  +
Sbjct: 336 EEHKYNVLVELYGLLTIGQSIIFCKKK 362


>SPAC17G6.14c |uap56||ATP-dependent RNA helicase
           Uap56|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 60.9 bits (141), Expect = 2e-10
 Identities = 31/85 (36%), Positives = 54/85 (63%), Gaps = 2/85 (2%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEML-SRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCF 437
           + L  N++K FVLDE D++L S   +  I +VF+      QV++ SAT+ +++  + + F
Sbjct: 191 KILKVNSVKHFVLDECDKLLESVDMRRDIQEVFRATPPQKQVMMFSATLSNEIRPICKKF 250

Query: 438 MRDPVRILVQKE-ELTLEGIKQFYM 509
           M++P+ I V  E +LTL G++Q Y+
Sbjct: 251 MQNPLEIYVDDETKLTLHGLQQHYV 275



 Score = 55.6 bits (128), Expect = 7e-09
 Identities = 32/89 (35%), Positives = 48/89 (53%), Gaps = 4/89 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHL-NAKCHACIGGTN 177
           GKTA F +S LQQI+    E   L+L  TRELA QI+        +L + +     GG N
Sbjct: 100 GKTAVFVLSTLQQIEPVDGEVSVLVLCHTRELAFQIKNEYARFSKYLPDVRTAVFYGGIN 159

Query: 178 VREDI---RQLESGVHVVVGTPGRVYDMI 255
           +++D+   +      H+VV TPGR+  ++
Sbjct: 160 IKQDMEAFKDKSKSPHIVVATPGRLNALV 188


>SPAC823.08c |||ATP-dependent RNA helicase Rrp3 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 465

 Score = 59.3 bits (137), Expect = 6e-10
 Identities = 30/83 (36%), Positives = 48/83 (57%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNV 180
           GKTA F++ ++Q++  +     A++LAPTRELA QI +   A+G  +  +    +GG ++
Sbjct: 95  GKTAAFALPVIQELWNNPSPFFAVVLAPTRELAYQISEQFEAIGGSIGVRSVVIVGGMDM 154

Query: 181 REDIRQLESGVHVVVGTPGRVYD 249
                 L    HV+V TPGR+ D
Sbjct: 155 VTQAVALSKKPHVLVCTPGRLMD 177



 Score = 50.0 bits (114), Expect = 4e-07
 Identities = 24/86 (27%), Positives = 44/86 (51%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR 431
           +  +      +K  ++DEAD +L   F   I  + KI+  + + +L SATM   V ++ R
Sbjct: 180 ENTKGFSLKNLKYLIMDEADRLLDMDFGPIIDKILKIIPHERRTLLFSATMTSKVEKLQR 239

Query: 432 CFMRDPVRILVQKEELTLEGIKQFYM 509
             +  PVR+ V  +  T++ + Q Y+
Sbjct: 240 ASLHQPVRVAVSSKFSTVDTLIQRYL 265


>SPCC63.11 |prp28||U5 snRNP-associated protein Prp28
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 662

 Score = 58.8 bits (136), Expect = 8e-10
 Identities = 28/63 (44%), Positives = 38/63 (60%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A++LAPTRELAQQIQ       + L  +C + +GG    E   Q+  G H+VV TPGR+ 
Sbjct: 328 AVVLAPTRELAQQIQVEGNKFAEPLGFRCVSVVGGHAFEEQSFQMSQGAHIVVATPGRLL 387

Query: 247 DMI 255
           D +
Sbjct: 388 DCL 390



 Score = 32.7 bits (71), Expect = 0.059
 Identities = 24/100 (24%), Positives = 45/100 (45%), Gaps = 19/100 (19%)
 Frame = +3

Query: 258 RRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKIL-------------------SADVQ 380
           RR    +     V+DEAD ML  GF+D ++ +   L                   S+  Q
Sbjct: 392 RRLFVLSQCTYVVMDEADRMLDMGFEDDVNKILSSLPSSNASEKDGSILATANSSSSRRQ 451

Query: 381 VILLSATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
            I+ SAT+P  V  +++ ++ +PV + +      ++ ++Q
Sbjct: 452 TIMFSATLPPRVANLAKSYLIEPVMLTIGNIGQAVDRVEQ 491


>SPBC4F6.07c |||ATP-dependent RNA helicase Mak5 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 648

 Score = 57.6 bits (133), Expect = 2e-09
 Identities = 34/87 (39%), Positives = 48/87 (55%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQI--DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKT  F I IL+    +   +  QAL++APTRELA QI +    +    N +  +  GG 
Sbjct: 171 GKTLAFGIPILEHCLRNVDAKYVQALVVAPTRELAHQICQHFELIKPSPNIRVMSITGGL 230

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
            V++  R L    HVVV TPGR++ +I
Sbjct: 231 AVQKQQRLLNKHPHVVVATPGRLWSVI 257



 Score = 27.1 bits (57), Expect = 2.9
 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 4/47 (8%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADV----QVILLSATMPD 410
           IK  VLDEAD +L +   +++  + +IL   +    Q  + SAT  +
Sbjct: 269 IKCLVLDEADRLLQKSHFEELSKLLEILGNPMHTQRQTFIFSATFDE 315


>SPAC30D11.03 |drs1||ATP-dependent RNA helicase Drs1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 754

 Score = 56.0 bits (129), Expect = 6e-09
 Identities = 26/76 (34%), Positives = 46/76 (60%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           I++ V+DEAD ML  GF D+++++ +      Q +L SATM D V ++ R  +  PVR+ 
Sbjct: 406 IEIMVMDEADRMLEDGFADELNEIIQACPKSRQTMLFSATMTDKVDDLIRLSLNRPVRVF 465

Query: 462 VQKEELTLEGIKQFYM 509
           V  ++ T + + Q ++
Sbjct: 466 VDNKKTTAKLLTQEFV 481



 Score = 54.4 bits (125), Expect = 2e-08
 Identities = 29/86 (33%), Positives = 44/86 (51%), Gaps = 3/86 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKTA F + IL+++      +   + LIL PTRELA Q   V   +    +     CIGG
Sbjct: 308 GKTAAFIVPILERLLYRPKKVPTTRVLILCPTRELAMQCHSVATKIASFTDIMVCLCIGG 367

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYD 249
            +++   ++L     +V+ TPGR  D
Sbjct: 368 LSLKLQEQELRKRPDIVIATPGRFID 393


>SPAC31A2.07c |dbp10||ATP-dependent RNA helicase Dbp10
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 848

 Score = 53.2 bits (122), Expect = 4e-08
 Identities = 30/82 (36%), Positives = 45/82 (54%), Gaps = 2/82 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIREC--QALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGT 174
           GKTA F I +++ + +++     +ALIL+P RELA Q  KVV       + +  A +GG 
Sbjct: 118 GKTAAFVIPMIEHLKSTLANSNTRALILSPNRELALQTVKVVKDFSKGTDLRSVAIVGGV 177

Query: 175 NVREDIRQLESGVHVVVGTPGR 240
           ++ E    L     +VV TPGR
Sbjct: 178 SLEEQFSLLSGKPDIVVATPGR 199



 Score = 47.2 bits (107), Expect = 3e-06
 Identities = 21/69 (30%), Positives = 39/69 (56%)
 Frame = +3

Query: 267 LHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRD 446
           L  ++I+  V DEAD +   GF  Q+ ++   L    Q +L SAT+P  +++ ++  ++D
Sbjct: 209 LELSSIEYVVFDEADRLFEMGFAAQLTEILHALPTSRQTLLFSATLPRTLVDFAKAGLQD 268

Query: 447 PVRILVQKE 473
           PV + +  E
Sbjct: 269 PVLVRLDVE 277


>SPBC21H7.04 |||ATP-dependent RNA helicase Dbp7 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 709

 Score = 50.8 bits (116), Expect = 2e-07
 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 11/94 (11%)
 Frame = +1

Query: 1   GKTATFSISILQQI-------DTSIRECQALILAPTRELAQQIQKVVIALGD----HLNA 147
           GKT  + + I+Q++        T      A+I+APTREL QQI  V   L +    H   
Sbjct: 190 GKTLAYLLPIVQRLIRLPKNLHTRTSGIYAVIMAPTRELCQQIYNVANKLNNNPLSHWIV 249

Query: 148 KCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
            C+  IGG   + +  ++  GV++++GTPGR+ D
Sbjct: 250 SCNV-IGGEKKKSEKARIRKGVNILIGTPGRLAD 282



 Score = 33.1 bits (72), Expect = 0.045
 Identities = 17/71 (23%), Positives = 34/71 (47%), Gaps = 1/71 (1%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPD-DVLEVS 428
           +   AL  + ++  VLDE D ++  GF++ +  +   L +   +I    ++P   V  + 
Sbjct: 285 ENTEALDVSQVRWVVLDEGDRLMDMGFEETLTKILSYLESQSSIIKKDLSIPSRKVTMLC 344

Query: 429 RCFMRDPVRIL 461
              M+D V+ L
Sbjct: 345 SATMKDTVKRL 355


>SPCC1795.11 |sum3|ded1, slh3, moc2|ATP-dependent RNA helicase
           Sum3|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 636

 Score = 50.8 bits (116), Expect = 2e-07
 Identities = 35/91 (38%), Positives = 50/91 (54%), Gaps = 4/91 (4%)
 Frame = +3

Query: 252 DTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFK---ILSADV-QVILLSATMPDDVL 419
           D  R   AN IK  VLDEAD ML  GF+ QI  + +   + S +  Q ++ SAT P D+ 
Sbjct: 321 DRGRISLAN-IKFLVLDEADRMLDMGFEPQIRHIVEGADMTSVEERQTLMFSATFPRDIQ 379

Query: 420 EVSRCFMRDPVRILVQKEELTLEGIKQFYMH 512
            ++R F++D V + V +   T E I Q  +H
Sbjct: 380 LLARDFLKDYVFLSVGRVGSTSENITQKVVH 410



 Score = 46.0 bits (104), Expect = 6e-06
 Identities = 25/62 (40%), Positives = 35/62 (56%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           LILAPTREL  QI +           +  A  GG ++R  IRQ++ G  ++  TPGR+ D
Sbjct: 259 LILAPTRELVCQIHEESRKFCYRSWVRPCAVYGGADIRAQIRQIDQGCDLLSATPGRLVD 318

Query: 250 MI 255
           +I
Sbjct: 319 LI 320


>SPBP8B7.16c |dbp2||ATP-dependent RNA helicase
           Dbp2|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 550

 Score = 50.8 bits (116), Expect = 2e-07
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +   VLDEAD ML  GF+ QI  +   +  D Q ++ SAT P +V  ++R ++ D +++ 
Sbjct: 270 VTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTVMFSATWPKEVQRLARDYLNDYIQVT 329

Query: 462 VQKEELTL-EGIKQ 500
           V   +L     IKQ
Sbjct: 330 VGSLDLAASHNIKQ 343



 Score = 49.6 bits (113), Expect = 5e-07
 Identities = 26/62 (41%), Positives = 33/62 (53%)
 Frame = +1

Query: 70  LILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYD 249
           L+LAPTRELA QIQ+     G     +     GG      IR L  GV + + TPGR+ D
Sbjct: 199 LVLAPTRELAVQIQQECTKFGKSSRIRNTCVYGGVPRGPQIRDLIRGVEICIATPGRLLD 258

Query: 250 MI 255
           M+
Sbjct: 259 ML 260


>SPCC10H11.01 |prp11||ATP-dependent RNA helicase
           Prp11|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1014

 Score = 48.4 bits (110), Expect = 1e-06
 Identities = 24/63 (38%), Positives = 36/63 (57%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVY 246
           A+I+ PTRELA QI +        LN +     GG  +++ I  L+ G  +VV TPGR+ 
Sbjct: 494 AIIMTPTRELAVQIFRECKPFLKLLNIRACCAYGGAPIKDQIADLKRGAEIVVCTPGRMI 553

Query: 247 DMI 255
           D++
Sbjct: 554 DVL 556



 Score = 46.4 bits (105), Expect = 4e-06
 Identities = 26/95 (27%), Positives = 43/95 (45%)
 Frame = +3

Query: 216 CGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLS 395
           C  G     +  +  R  + +     VLDEAD M   GF+ Q+  +   +  D Q +L S
Sbjct: 547 CTPGRMIDVLSANAGRVTNLHRCTYLVLDEADRMFDLGFEPQVMRIINNIRPDRQTVLFS 606

Query: 396 ATMPDDVLEVSRCFMRDPVRILVQKEELTLEGIKQ 500
           AT P  +  ++R  ++ PV I V    +    ++Q
Sbjct: 607 ATFPRAMEALARKVLKKPVEITVGGRSVVASEVEQ 641


>SPBC17D1.06 |dbp3||ATP-dependent RNA helicase Dbp3
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 578

 Score = 48.4 bits (110), Expect = 1e-06
 Identities = 24/77 (31%), Positives = 41/77 (53%), Gaps = 5/77 (6%)
 Frame = +3

Query: 264 ALHANTIKLFVLDEADEMLSRGFKDQIHDVFK-----ILSADVQVILLSATMPDDVLEVS 428
           ++  + +   VLDEAD ML  GF+  I ++         +   Q +  SAT P+ V  ++
Sbjct: 304 SIDCSQVGYLVLDEADRMLDTGFEQDIRNIISHTPDPTRNGSRQTVFFSATWPESVRALA 363

Query: 429 RCFMRDPVRILVQKEEL 479
             F++DPV+I +  +EL
Sbjct: 364 ATFLKDPVKITIGSDEL 380



 Score = 46.4 bits (105), Expect = 4e-06
 Identities = 30/88 (34%), Positives = 46/88 (52%), Gaps = 3/88 (3%)
 Frame = +1

Query: 1   GKTATFSISILQQID---TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG 171
           GKT  F I  LQ ++    +    + L+++PTRELA Q  + + +L    N K     GG
Sbjct: 214 GKTVAFGIPALQYLNGLSDNKSVPRVLVVSPTRELAIQTYENLNSLIQGTNLKAVVVYGG 273

Query: 172 TNVREDIRQLESGVHVVVGTPGRVYDMI 255
               E  R  ++   V++GTPGR+ D+I
Sbjct: 274 APKSEQARAAKN-ASVIIGTPGRLLDLI 300


>SPAC22F3.08c |rok1||ATP-dependent RNA helicase Rok1
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 481

 Score = 48.0 bits (109), Expect = 1e-06
 Identities = 25/74 (33%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQI-HDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRI 458
           ++ FV+DEAD +   GF +Q  H +    S+++   L SAT+P  V E+++    DP+RI
Sbjct: 190 VEFFVMDEADRLFEPGFIEQTDHILSACTSSNICKSLFSATIPSRVEELAKVVTVDPIRI 249

Query: 459 LVQKEELTLEGIKQ 500
           +V  ++   + I Q
Sbjct: 250 IVGLKDAATDSIDQ 263



 Score = 36.3 bits (80), Expect = 0.005
 Identities = 25/87 (28%), Positives = 41/87 (47%), Gaps = 2/87 (2%)
 Frame = +1

Query: 1   GKTATFSISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAK-CHACIGGT 174
           GKT  +   ILQ++   +    +A+I+APTREL +QI +    L    + K         
Sbjct: 95  GKTIAYLFPILQKLQLHVPGGYRAIIVAPTRELCEQIYRQAEKLSFGTSLKIIELSKSNE 154

Query: 175 NVREDIRQLESGVHVVVGTPGRVYDMI 255
            ++E   +L     + +GTP R+   I
Sbjct: 155 KIQEKAPKLREKYDMCIGTPMRLVQAI 181


>SPAC1093.05 |||ATP-dependent RNA helicase Hca4 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 735

 Score = 48.0 bits (109), Expect = 1e-06
 Identities = 29/89 (32%), Positives = 51/89 (57%), Gaps = 4/89 (4%)
 Frame = +1

Query: 1   GKTATFSISILQQID----TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F + +++ +     TS+    AL+++PTRELA Q  + ++ +G   +      IG
Sbjct: 88  GKTLAFIVPLIENLYRKKWTSLDGLGALVISPTRELAIQTFETLVKIGRLHSFSAGLIIG 147

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYDMI 255
           G N +E+  +L S ++++V TPGR+   I
Sbjct: 148 GNNYKEEKERL-SRMNILVCTPGRLLQHI 175



 Score = 44.4 bits (100), Expect = 2e-05
 Identities = 23/78 (29%), Positives = 42/78 (53%), Gaps = 2/78 (2%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSRCFMRDPVRIL 461
           +++ +LDEAD +L  GF+  +  +   L    Q +L SAT    V +++R  +++P  I 
Sbjct: 186 LQMLILDEADRILDMGFRTTLDAIVSSLPVHRQTMLFSATQTKSVKDLARLSLQNPDFIS 245

Query: 462 VQKEEL--TLEGIKQFYM 509
           V + +   T   + QFY+
Sbjct: 246 VHENDTSSTPSNLNQFYL 263


>SPAC1F7.02c |||ATP-dependent RNA helicase Has1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 578

 Score = 47.2 bits (107), Expect = 3e-06
 Identities = 28/80 (35%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKIL-SADVQVILLSATMPDDVLEVSRCFMR-DPVR 455
           ++  V+DEAD +L  GF+D++  + KIL S + Q +L SAT    V +++R  ++  P+ 
Sbjct: 237 LRSLVIDEADRILEIGFEDEMRQIMKILPSENRQTLLFSATQTTKVEDLARISLKPGPLY 296

Query: 456 ILVQ--KEELTLEGIKQFYM 509
           + V   K   T+EG++Q Y+
Sbjct: 297 VNVDSGKPTSTVEGLEQGYV 316



 Score = 46.0 bits (104), Expect = 6e-06
 Identities = 32/87 (36%), Positives = 46/87 (52%), Gaps = 4/87 (4%)
 Frame = +1

Query: 1   GKTATF---SISILQQIDTSIRE-CQALILAPTRELAQQIQKVVIALGDHLNAKCHACIG 168
           GKT  F   +I +L  +    R     +I++PTRELA QI  V   L  + +      IG
Sbjct: 138 GKTLAFLIPTIEMLYALKFKPRNGTGVIIISPTRELALQIFGVAKELLKYHHQTFGIVIG 197

Query: 169 GTNVREDIRQLESGVHVVVGTPGRVYD 249
           G N R +  +L  GV+++V TPGR+ D
Sbjct: 198 GANRRAEADKLVKGVNLLVATPGRLLD 224


>SPCC1494.06c |||ATP-dependent RNA helicase Dbp9
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 595

 Score = 44.8 bits (101), Expect = 1e-05
 Identities = 22/79 (27%), Positives = 42/79 (53%)
 Frame = +3

Query: 240 CI*YDTRRALHANTIKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVL 419
           C+ +     L  + +K  V+DEAD MLS G+ + +  + + L    Q  L+SAT+  ++ 
Sbjct: 151 CVVHVASGVLPLDKLKFLVIDEADLMLSFGYNEDMKTLSRSLPRGTQSFLMSATLSKNIA 210

Query: 420 EVSRCFMRDPVRILVQKEE 476
            + +   R+P  + V+ +E
Sbjct: 211 SLQKLVCRNPFILAVKDKE 229



 Score = 40.3 bits (90), Expect = 3e-04
 Identities = 31/88 (35%), Positives = 44/88 (50%), Gaps = 8/88 (9%)
 Frame = +1

Query: 1   GKTATFSISILQ------QIDTSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHAC 162
           GKTA + I IL+      QID + R   AL+L PTRELAQQ+  V+  L    +      
Sbjct: 63  GKTAAYLIPILELLLKQKQIDENQRGIFALLLVPTRELAQQVYNVLEKLTAFCSKHIRFI 122

Query: 163 IGGTNVREDIRQ--LESGVHVVVGTPGR 240
              TN  + +++  L     +V+ TP R
Sbjct: 123 NVATNSSDTVQRPLLLDLPDIVIATPSR 150


>SPCC285.03 |||ATP-dependent RNA helicase Dbp6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 604

 Score = 39.5 bits (88), Expect = 5e-04
 Identities = 27/91 (29%), Positives = 45/91 (49%), Gaps = 6/91 (6%)
 Frame = +1

Query: 1   GKTATFSISILQQID-TSIRECQALILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTN 177
           GKT ++ I I+Q +   ++   + +++ PTREL  Q+ K           +  A  G  +
Sbjct: 185 GKTLSYVIPIVQCLSHRTVPRLRCVVIVPTRELTVQVAKTFEYYMSGAGLQVCAWTGQKS 244

Query: 178 VREDIRQL-----ESGVHVVVGTPGRVYDMI 255
           +R +  QL     E  + V+V TPGR+ D I
Sbjct: 245 LRHETYQLNGDENECRIDVLVSTPGRLVDHI 275



 Score = 26.2 bits (55), Expect = 5.1
 Identities = 10/29 (34%), Positives = 18/29 (62%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILS 368
           ++  V+DEAD +L + F+D +  V   +S
Sbjct: 286 LRYMVIDEADRLLDQSFQDWVDTVMMEIS 314



 Score = 25.8 bits (54), Expect = 6.8
 Identities = 14/63 (22%), Positives = 34/63 (53%), Gaps = 1/63 (1%)
 Frame = +3

Query: 303 EADEMLSRGFKDQIHDVFKI-LSADVQVILLSATMPDDVLEVSRCFMRDPVRILVQKEEL 479
           + D+ +S  F   I  +    L + +Q ++ SAT+  D  +++   + +P  +LVQ +++
Sbjct: 327 DLDQNISPTFLPDIDTLLPYRLPSPLQKLVFSATLTRDPSKIASLKLHNPRLVLVQNKDM 386

Query: 480 TLE 488
            ++
Sbjct: 387 EVD 389


>SPBC691.04 |||mitochondrial ATP-dependent RNA helicase Mss116
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 535

 Score = 37.5 bits (83), Expect = 0.002
 Identities = 24/80 (30%), Positives = 42/80 (52%), Gaps = 1/80 (1%)
 Frame = +1

Query: 67  ALILAPTRELAQQIQKVVIALGDHLNAKCHACIGG-TNVREDIRQLESGVHVVVGTPGRV 243
           ++IL+PTRELA QI +    L      +    IGG + +RE+        ++++ TPGR+
Sbjct: 115 SVILSPTRELALQIFEEARKLTYGTGIRVSYAIGGNSKMREENAIRRGNANLLIATPGRL 174

Query: 244 YDMILVVRFMPTPSNFLFLM 303
            D +   R + + S   F++
Sbjct: 175 EDHLQNPRILESLSTDSFIL 194



 Score = 37.5 bits (83), Expect = 0.002
 Identities = 25/85 (29%), Positives = 42/85 (49%), Gaps = 4/85 (4%)
 Frame = +3

Query: 261 RALHANTIKLFVLDEADEMLSRGFKDQIHDVFK-ILSADVQVILLSATMPDDVLEVSRCF 437
           R L + +   F+LDEAD ++  GF + I ++ + + +   + +  SATMP  V  V R  
Sbjct: 182 RILESLSTDSFILDEADRLMDMGFAESILNIHEAVTTTKTRKLCFSATMPPKVSNVFRGI 241

Query: 438 MRDPVRI---LVQKEELTLEGIKQF 503
           +    ++   L   E  T E + QF
Sbjct: 242 LGTDFKLINCLDPNEPPTHERVPQF 266


>SPBC24C6.02 |||ATP-dependent RNA helicase Spb4 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 606

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 33/98 (33%), Positives = 44/98 (44%), Gaps = 13/98 (13%)
 Frame = +1

Query: 1   GKTATFSISILQQI---DTSIRECQALILAPTRELAQQIQKVVIAL----------GDHL 141
           GKT  + +    ++   DT      ALI+APTRELA QI  V   L          G  L
Sbjct: 50  GKTLAYLLPCFDKVTRRDTDETGLGALIVAPTRELATQIFNVTKELLAYQPDSLDGGKKL 109

Query: 142 NAKCHACIGGTNVREDIRQLESGVHVVVGTPGRVYDMI 255
            A  +    GT   +     E    VV+GTPGR+ +M+
Sbjct: 110 VADMYIGGKGTLTNDLASFREKNPSVVIGTPGRLNEML 147



 Score = 34.7 bits (76), Expect = 0.015
 Identities = 19/62 (30%), Positives = 33/62 (53%), Gaps = 1/62 (1%)
 Frame = +3

Query: 282 IKLFVLDEADEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVLEVSR-CFMRDPVRI 458
           +++ +LDEAD ++  GF+  +  +   L    +  L SATM D V    +   +R+ VR+
Sbjct: 155 LEILILDEADTLIDMGFQRTLQSIISQLPKQRRTGLFSATMNDTVSSFLKIAGLRNSVRV 214

Query: 459 LV 464
            V
Sbjct: 215 SV 216


>SPAPJ696.01c |vps17||retromer complex subunit
           Vps17|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 549

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 12/34 (35%), Positives = 19/34 (55%)
 Frame = +3

Query: 27  DSTTNRYKHS*MSSFDPGSHKRAGPTNSEGGDSS 128
           D+ TNR +    SSFD  S     P+N++G  ++
Sbjct: 487 DAWTNRKRPGYSSSFDGSSQSTFNPSNNDGAHNT 520


>SPAC328.01c ||SPAC3A11.01|karyopherin|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 1234

 Score = 26.2 bits (55), Expect = 5.1
 Identities = 12/37 (32%), Positives = 20/37 (54%)
 Frame = +3

Query: 309 DEMLSRGFKDQIHDVFKILSADVQVILLSATMPDDVL 419
           +EMLS      +H V+   S  + +  LS+T P+ +L
Sbjct: 299 EEMLSPSSLYTLHQVYTATSESINIKTLSSTTPEYIL 335


>SPAC27E2.07 |pvg2|mug53|galactose residue biosynthesis protein
           Pvg2|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 389

 Score = 26.2 bits (55), Expect = 5.1
 Identities = 11/24 (45%), Positives = 17/24 (70%)
 Frame = -1

Query: 141 QVITKSYHHLLNLLGQLSCGSQDQ 70
           +++ KSYH+L N   QLS  ++DQ
Sbjct: 165 ELVDKSYHNLHNAWSQLSREAKDQ 188


>SPBC428.04 |||sequence orphan|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 115

 Score = 26.2 bits (55), Expect = 5.1
 Identities = 11/31 (35%), Positives = 18/31 (58%)
 Frame = +1

Query: 328 VSRTRSMMSSRFCQLMFKSYYSLLPCLMMYW 420
           V++T S+  + F  L   S++ L+ CL  YW
Sbjct: 78  VNKTTSIALALFKTLAVISFFLLIGCLFAYW 108


>SPAC27E2.10c |rfc3|SPAPJ698.01c|DNA replication factor C complex
           subunit Rfc3 |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 342

 Score = 26.2 bits (55), Expect = 5.1
 Identities = 10/23 (43%), Positives = 16/23 (69%)
 Frame = +3

Query: 249 YDTRRALHANTIKLFVLDEADEM 317
           + + R + A+T K+ +LDEAD M
Sbjct: 110 FASTRQIFASTFKMIILDEADAM 132


>SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase
            Mok11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2397

 Score = 25.8 bits (54), Expect = 6.8
 Identities = 16/48 (33%), Positives = 22/48 (45%)
 Frame = +3

Query: 195  PTGEWCSCGGGHSRSCI*YDTRRALHANTIKLFVLDEADEMLSRGFKD 338
            P  EW S    H R+CI +  ++ L  + I   V+D  DE      KD
Sbjct: 1599 PVSEWVSKLDTHVRNCIKFSHKQNLEEDFIHEPVID-VDEFAISSSKD 1645


>SPCC736.08 |cbf11||CBF1/Su|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 613

 Score = 25.8 bits (54), Expect = 6.8
 Identities = 10/28 (35%), Positives = 17/28 (60%)
 Frame = +1

Query: 106 IQKVVIALGDHLNAKCHACIGGTNVRED 189
           ++ +  A+ DHL+   + CIG  N+ ED
Sbjct: 134 VEMIRRAISDHLDLLNNCCIGIANLNED 161


>SPAC4H3.13 |||transcription factor Pcc1 |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 88

 Score = 25.8 bits (54), Expect = 6.8
 Identities = 11/53 (20%), Positives = 27/53 (50%)
 Frame = +1

Query: 73  ILAPTRELAQQIQKVVIALGDHLNAKCHACIGGTNVREDIRQLESGVHVVVGT 231
           +LAP REL +++ +  + + D+     ++C      R  +  L   +++++ T
Sbjct: 29  VLAPDRELKEELVQRNLFVDDNYLVVNYSCSSARMTRVTVNSLFENLYLIIDT 81


>SPBC25H2.03 |||vacuolar protein involved in phosphoinositide
           metabolism|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 811

 Score = 25.8 bits (54), Expect = 6.8
 Identities = 13/37 (35%), Positives = 22/37 (59%), Gaps = 3/37 (8%)
 Frame = -1

Query: 201 QLANIFTDIGAT---NASMAFSIQVITKSYHHLLNLL 100
           +L NIFT +      N+   FS+ +++++Y H  NLL
Sbjct: 598 KLQNIFTTLYTAWCHNSIAVFSLCLLSQNYEHAANLL 634


>SPBC1709.17 |||folylpolyglutamate synthase|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 505

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 16/42 (38%), Positives = 24/42 (57%), Gaps = 5/42 (11%)
 Frame = +1

Query: 1   GKTATFSISILQQI----DTSIRECQALILAP-TRELAQQIQ 111
           G T  F+ SILQQI    + SI +C  +  +P  R + ++IQ
Sbjct: 91  GSTCAFTSSILQQIQKSGERSIPKCIGMYTSPHLRSVCERIQ 132


>SPBC947.06c |||spermidine family transporter |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 498

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 14/47 (29%), Positives = 19/47 (40%)
 Frame = -1

Query: 282 WCWHEAHDEYHIIYTTWSAHHHMNTTLQLANIFTDIGATNASMAFSI 142
           W  H AHDEY + +  +   H +     LA       A  AS  + I
Sbjct: 257 WGLHAAHDEYRLDFKEFVTLHLVRPFAMLATPIVFFIAMFASYVYGI 303


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,446,169
Number of Sequences: 5004
Number of extensions: 75267
Number of successful extensions: 291
Number of sequences better than 10.0: 34
Number of HSP's better than 10.0 without gapping: 237
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 278
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 367316502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).