SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30026
         (796 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC23D3.12 |||inorganic phosphate transporter |Schizosaccharomy...    30   0.44 
SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomy...    29   0.58 
SPCC2H8.02 |||inorganic phosphate transporter|Schizosaccharomyce...    29   1.0  
SPBC8E4.01c ||SPBP4G3.01|inorganic phosphate transporter |Schizo...    28   1.3  
SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|ch...    28   1.8  
SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase |Schizosac...    27   2.3  
SPCC576.15c |ksg1||serine/threonine protein kinase Ksg1|Schizosa...    27   2.3  
SPAC607.07c |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    26   5.4  
SPAC27D7.13c |ssm4|SPAC637.01c|p150-Glued|Schizosaccharomyces po...    26   7.1  
SPAC9E9.06c |||threonine synthase |Schizosaccharomyces pombe|chr...    26   7.1  
SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces ...    25   9.4  
SPAC4H3.05 |srs2||ATP-dependent DNA helicase, UvrD subfamily|Sch...    25   9.4  

>SPAC23D3.12 |||inorganic phosphate transporter |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 559

 Score = 29.9 bits (64), Expect = 0.44
 Identities = 13/28 (46%), Positives = 16/28 (57%)
 Frame = +2

Query: 344 GLINMAFMSGGVASAFFWGIVGDVFGRK 427
           GL+N A   G V     +G +GD FGRK
Sbjct: 91  GLVNAAANIGNVFGQILFGFMGDFFGRK 118


>SPBC1683.01 |||inorganic phosphate transporter |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 573

 Score = 29.5 bits (63), Expect = 0.58
 Identities = 12/28 (42%), Positives = 16/28 (57%)
 Frame = +2

Query: 344 GLINMAFMSGGVASAFFWGIVGDVFGRK 427
           GL+N A   G +     +G +GD FGRK
Sbjct: 96  GLVNAASNIGNIFGQLMFGFMGDFFGRK 123


>SPCC2H8.02 |||inorganic phosphate transporter|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 583

 Score = 28.7 bits (61), Expect = 1.0
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +2

Query: 344 GLINMAFMSGGVASAFFWGIVGDVFGRK 427
           G++N A   G +     +G +GD FGRK
Sbjct: 86  GVVNAATNIGNIMGQLLFGFLGDFFGRK 113


>SPBC8E4.01c ||SPBP4G3.01|inorganic phosphate transporter
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 572

 Score = 28.3 bits (60), Expect = 1.3
 Identities = 11/28 (39%), Positives = 16/28 (57%)
 Frame = +2

Query: 344 GLINMAFMSGGVASAFFWGIVGDVFGRK 427
           GL+N +   G +     +G +GD FGRK
Sbjct: 96  GLVNASANIGNIFGQLLFGFMGDFFGRK 123


>SPBC3E7.06c |||membrane transporter|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 577

 Score = 27.9 bits (59), Expect = 1.8
 Identities = 15/41 (36%), Positives = 23/41 (56%)
 Frame = +1

Query: 508 AARTINGFIIGGPATLVFTYLSDLVGVKKRQFYLSMVGMSF 630
           AAR I G   GG  + V   +SD+V +K+R  Y  ++ + F
Sbjct: 182 AARAIAGIGGGGMNSTVSILMSDIVPLKQRGTYQGIINVFF 222


>SPBC1718.04 |||glycerol-3-phosphate O-acyltransferase
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 675

 Score = 27.5 bits (58), Expect = 2.3
 Identities = 19/53 (35%), Positives = 29/53 (54%), Gaps = 1/53 (1%)
 Frame = -2

Query: 489 GTVLWAKV-IAASRSNVKLRVLFLPKTSPTIPQKNALATPPLIKAMLINPAWY 334
           G +L++ V IAA R +VK     L  +S  I  ++ LAT  L+ A+ + P  Y
Sbjct: 407 GAILFSPVFIAAHRISVKKAAAALKASSVKIQGRDILATWKLLVALGMTPILY 459


>SPCC576.15c |ksg1||serine/threonine protein kinase
           Ksg1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 592

 Score = 27.5 bits (58), Expect = 2.3
 Identities = 18/49 (36%), Positives = 25/49 (51%), Gaps = 1/49 (2%)
 Frame = -2

Query: 450 SNVKLRVLFLPKT-SPTIPQKNALATPPLIKAMLINPAWYVVSCSSHLA 307
           S+ KL    LPKT +  IPQ NAL T P      I+ +  + S   H++
Sbjct: 32  SSEKLNRASLPKTQNSAIPQSNALNTTPNESTSQIDSSPKIPSAVPHIS 80


>SPAC607.07c |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 143

 Score = 26.2 bits (55), Expect = 5.4
 Identities = 15/64 (23%), Positives = 27/64 (42%)
 Frame = -2

Query: 549 SWTSYNEPIDGSSCSRSL*SGTVLWAKVIAASRSNVKLRVLFLPKTSPTIPQKNALATPP 370
           +W     P   S+   +L +  +   +V  A  + +     F+  TS T+P  N  A PP
Sbjct: 49  TWNFLKNPFSNSAKFEALDADDMWDTRVEEAELNTIPSASPFIDHTSETVPFVNTEAPPP 108

Query: 369 LIKA 358
            + +
Sbjct: 109 RLSS 112


>SPAC27D7.13c |ssm4|SPAC637.01c|p150-Glued|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 670

 Score = 25.8 bits (54), Expect = 7.1
 Identities = 9/19 (47%), Positives = 14/19 (73%)
 Frame = +2

Query: 548 LHWSSRIYQT*LELRRDNS 604
           +HW+S +YQ  L L+ +NS
Sbjct: 381 VHWNSTVYQELLNLKSNNS 399


>SPAC9E9.06c |||threonine synthase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 514

 Score = 25.8 bits (54), Expect = 7.1
 Identities = 11/23 (47%), Positives = 16/23 (69%)
 Frame = +2

Query: 68  NIFFFSLTQNNGSENRPENRKPH 136
           N+F F LT+ NG  N+PE+ + H
Sbjct: 126 NLFEFFLTRKNG--NKPEDERDH 146


>SPAC144.07c |||conserved eukaryotic protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 315

 Score = 25.4 bits (53), Expect = 9.4
 Identities = 11/32 (34%), Positives = 19/32 (59%)
 Frame = -2

Query: 741 QARNNLHGVNWQERWIVRDFKWNHHPGECRQK 646
           Q  + L G++ QERWI +  +++ +  E  QK
Sbjct: 274 QGGDPLQGISPQERWIDKKEEYDKYEWELEQK 305


>SPAC4H3.05 |srs2||ATP-dependent DNA helicase, UvrD
           subfamily|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 887

 Score = 25.4 bits (53), Expect = 9.4
 Identities = 9/13 (69%), Positives = 10/13 (76%)
 Frame = -2

Query: 174 LRWHLVRLPCLCE 136
           L W +V LPCLCE
Sbjct: 598 LEWPVVFLPCLCE 610


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,514,162
Number of Sequences: 5004
Number of extensions: 77665
Number of successful extensions: 200
Number of sequences better than 10.0: 12
Number of HSP's better than 10.0 without gapping: 197
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 200
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 387388442
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).