SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30025
         (734 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBP4H10.06c |cut14|smc2, smc2|condensin subunit Cut14|Schizosac...    27   2.1  
SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr 1||...    25   8.5  

>SPBP4H10.06c |cut14|smc2, smc2|condensin subunit
            Cut14|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1172

 Score = 27.5 bits (58), Expect = 2.1
 Identities = 17/61 (27%), Positives = 29/61 (47%), Gaps = 1/61 (1%)
 Frame = +1

Query: 70   IKNHETWSLLNTLFHSMEV-YVESENNVQKCIEIIIVHNVMVGETNQEIVIKKFSFNTMK 246
            ++   T SL+ T    +E+  V  E+N +K  E+I + +      N+EI     S  T +
Sbjct: 842  VQGESTTSLIKTEIAELELSLVNEEHNRKKLTELIEIESAKFSGLNKEIDSLSTSMKTFE 901

Query: 247  S 249
            S
Sbjct: 902  S 902


>SPAC1952.01 ||SPAC1B3.19|Pig-U|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 408

 Score = 25.4 bits (53), Expect = 8.5
 Identities = 14/50 (28%), Positives = 24/50 (48%)
 Frame = -1

Query: 488 IPGVIFFNSHEFLNFIPNKGKVRYVFFPIFN*YQNIFYYSNIIYKRCFII 339
           IP  ++ +SH+     PN G   Y F  +FN ++  F +   I    F++
Sbjct: 234 IPFRVYLDSHDLT---PNLGLWWYFFTEMFNEFRTFFLFVFAILPLMFVL 280


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,021,147
Number of Sequences: 5004
Number of extensions: 62719
Number of successful extensions: 137
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 133
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 137
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 347244562
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).