SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30024
         (540 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC622.18 |rpl6||60S ribosomal protein L6|Schizosaccharomyces p...    69   3e-13
SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces pombe...    25   5.4  

>SPCC622.18 |rpl6||60S ribosomal protein L6|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 195

 Score = 69.3 bits (162), Expect = 3e-13
 Identities = 41/87 (47%), Positives = 53/87 (60%), Gaps = 5/87 (5%)
 Frame = +3

Query: 246 PTQLKI----GTVCILLAGRHAGKRVVLVGILPSGLLLVTGPFAFNSCPLRRIPQRYVIG 413
           PT+L+     GTVCILLAGR  GKRVV++  L    L+VTGP+  N  P+RR+  RYVI 
Sbjct: 45  PTKLRASLAPGTVCILLAGRFRGKRVVVLSQLED-TLVVTGPYKVNGVPIRRVNHRYVIA 103

Query: 414 TST-RISLGNFKLPKHFNDDYFKKNKK 491
           TS  +I +    + K F   YF K K+
Sbjct: 104 TSAPKIDVSGVSVEK-FTKAYFAKQKR 129


>SPBC800.03 |clr3||histone deacetylase |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 687

 Score = 25.4 bits (53), Expect = 5.4
 Identities = 17/41 (41%), Positives = 20/41 (48%), Gaps = 5/41 (12%)
 Frame = +2

Query: 152 YPSNVGSPST-----PLRRKSVLHLVAVHSASMYAGSDPTE 259
           Y SNV SPS      P R  ++  L+ VHS  MY     TE
Sbjct: 96  YVSNVPSPSDVFLRIPAREATLEELLQVHSQEMYDRVTNTE 136


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,216,884
Number of Sequences: 5004
Number of extensions: 43743
Number of successful extensions: 105
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 103
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 104
length of database: 2,362,478
effective HSP length: 69
effective length of database: 2,017,202
effective search space used: 221892220
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).