SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30023
         (770 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC530.10c |anc1||adenine nucleotide carrier Anc1|Schizosacchar...    73   5e-14
SPAC19G12.05 |||mitochondrial citrate transporter|Schizosaccharo...    40   4e-04
SPAC328.09 |||2-oxoadipate and 2-oxoglutarate transporter |Schiz...    38   0.002
SPAC4G9.20c |||mitochondrial carrier with solute carrier repeats...    37   0.003
SPBC12D12.05c |||mitochondrial carrier, calcium binding subfamil...    34   0.020
SPAC8C9.12c |||iron ion transporter |Schizosaccharomyces pombe|c...    34   0.026
SPAPB17E12.12c |||mitochondrial transporter|Schizosaccharomyces ...    32   0.10 
SPAC139.02c |oac1||anion transporter|Schizosaccharomyces pombe|c...    31   0.18 
SPAC823.10c |||mitochondrial carrier with solute carrier repeats...    29   0.56 
SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S...    29   0.74 
SPCC1442.03 ||SPCC1450.19|ATP-Mg/Pi carrier homolog|Schizosaccha...    29   0.97 
SPAC227.03c |||mitochondrial NAD+ transporter|Schizosaccharomyce...    28   1.7  
SPCC970.10c |brl2|rfp1|ubiquitin-protein ligase E3 Brl2|Schizosa...    27   3.9  
SPAC688.09 |||pyrimidine nucletide transporter |Schizosaccharomy...    26   6.9  
SPAC17H9.08 |||mitochondrial coenzyme A transporter|Schizosaccha...    26   6.9  
SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual    26   6.9  

>SPBC530.10c |anc1||adenine nucleotide carrier
           Anc1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 322

 Score = 72.9 bits (171), Expect = 5e-14
 Identities = 34/73 (46%), Positives = 47/73 (64%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGA 180
           + SYP DT+RRRMMM SG A   + Y ++  C   I   EG   FFKGA +N+LRG  GA
Sbjct: 248 VASYPLDTIRRRMMMTSGEA---VKYSSSFECGRQILAKEGARSFFKGAGANILRGVAGA 304

Query: 181 FVLVLYDEIKKVL 219
            VL +YD+++ ++
Sbjct: 305 GVLSIYDQVQLLM 317


>SPAC19G12.05 |||mitochondrial citrate
           transporter|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 291

 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 25/70 (35%), Positives = 37/70 (52%), Gaps = 1/70 (1%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGAFVL 189
           P DTV+ RM  QS  A  +  YKN+IHC   I   +G   F+ GA   + R    G  V 
Sbjct: 223 PIDTVKSRM--QSLSASKE--YKNSIHCAYKILTQDGLLRFWSGATPRLARLILSGGIVF 278

Query: 190 VLYDEIKKVL 219
            +Y+++ ++L
Sbjct: 279 TVYEKVMEIL 288


>SPAC328.09 |||2-oxoadipate and 2-oxoglutarate transporter
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 298

 Score = 37.9 bits (84), Expect = 0.002
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 1/69 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           +S PFD ++ R+      A     Y        T+A+ EG +  +KG    VLR G GG 
Sbjct: 216 LSTPFDVIKSRIQTVPRIAGQVPKYNWAYPALVTVAREEGFTALYKGFVPKVLRLGPGGG 275

Query: 181 FVLVLYDEI 207
            +LV+++ +
Sbjct: 276 ILLVVFNSV 284


>SPAC4G9.20c |||mitochondrial carrier with solute carrier
           repeats|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 302

 Score = 37.1 bits (82), Expect = 0.003
 Identities = 17/48 (35%), Positives = 27/48 (56%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKG 144
           ++  PFD V+ R+  QS  +    +Y N + C   I+K EG + F+KG
Sbjct: 33  LVGQPFDCVKVRLQSQSNVSP---IYNNALDCVKKISKNEGLAAFYKG 77


>SPBC12D12.05c |||mitochondrial carrier, calcium binding
           subfamily|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 426

 Score = 34.3 bits (75), Expect = 0.020
 Identities = 21/73 (28%), Positives = 33/73 (45%), Gaps = 1/73 (1%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR-GTGGA 180
           I +P + +R R+  Q G +     Y   I C+    K EG    +KG   N+L+     A
Sbjct: 352 IVFPLNVIRTRLQTQ-GTSAHPATYDGFIDCFYKTTKNEGFRGLYKGLSPNLLKVAPSVA 410

Query: 181 FVLVLYDEIKKVL 219
              ++Y+  KK L
Sbjct: 411 ISYLVYENCKKWL 423


>SPAC8C9.12c |||iron ion transporter |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 303

 Score = 33.9 bits (74), Expect = 0.026
 Identities = 14/42 (33%), Positives = 24/42 (57%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFF 138
           PFD +++RM + S +      YK+ +HC  T+ + EG   F+
Sbjct: 133 PFDVIKQRMQLPSRK------YKSALHCATTVFRNEGLGAFY 168


>SPAPB17E12.12c |||mitochondrial transporter|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 317

 Score = 31.9 bits (69), Expect = 0.10
 Identities = 19/54 (35%), Positives = 28/54 (51%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           +++P D +RRR  +          YKN       I KTEG + FF+G  SN+L+
Sbjct: 243 LTFPADVLRRRFQVNRIPGIGHN-YKNIKSAIFHIYKTEGINGFFRGYSSNMLK 295


>SPAC139.02c |oac1||anion transporter|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 320

 Score = 31.1 bits (67), Expect = 0.18
 Identities = 21/72 (29%), Positives = 35/72 (48%), Gaps = 3/72 (4%)
 Frame = +1

Query: 13  PFDTVRRRMMMQSGR--AKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           PF  V+ RM   S +        YK+  + ++ I K  G    F GA + +LR   G+ V
Sbjct: 148 PFFLVKTRMQSYSPKFPVGQQYGYKHIFNAFSRIIKENGVKGLFVGADAAILRTVSGSSV 207

Query: 187 -LVLYDEIKKVL 219
            L +Y+  K+++
Sbjct: 208 QLPIYNWAKRMI 219



 Score = 31.1 bits (67), Expect = 0.18
 Identities = 19/50 (38%), Positives = 26/50 (52%)
 Frame = +1

Query: 16  FDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           FDTV  RM  Q    K+  LYKN I C     ++EG    +KG  +++ R
Sbjct: 250 FDTVMTRMYNQ----KNKELYKNPIDCILKTIRSEGFFALYKGFGAHLAR 295


>SPAC823.10c |||mitochondrial carrier with solute carrier
           repeats|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 296

 Score = 29.5 bits (63), Expect = 0.56
 Identities = 17/54 (31%), Positives = 26/54 (48%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLR 165
           I+ PFD ++ R+ ++        +YKN +H    +   EG   F  G F  VLR
Sbjct: 227 ITNPFDMLKTRVQLEPH------IYKNFLHSAKLVYANEGFRGFLDGFFLRVLR 274


>SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase
            Mok11|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 2397

 Score = 29.1 bits (62), Expect = 0.74
 Identities = 13/42 (30%), Positives = 22/42 (52%)
 Frame = +3

Query: 51   WSCQERYPVQEHHPLLGYHCQDRGNLALLQGSLLQRPQRYWW 176
            WS   RY  + HH ++ Y  +  G+   +Q S L+ P + W+
Sbjct: 908  WSQSSRYGWKGHHIMVQYWSELTGSSNYMQESDLEYPYKRWF 949


>SPCC1442.03 ||SPCC1450.19|ATP-Mg/Pi carrier
           homolog|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 338

 Score = 28.7 bits (61), Expect = 0.97
 Identities = 19/77 (24%), Positives = 38/77 (49%), Gaps = 5/77 (6%)
 Frame = +1

Query: 1   IISYPFDTVRRRMMMQ----SGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRG 168
           ++  P + ++ R+ +Q    +   +S+  Y +       IAK EG   FF G  + +LR 
Sbjct: 126 VVYVPSEVLKTRLQLQGRYNNPHFQSNYNYPSFRGAVKQIAKQEGMKTFFYGYRATILRD 185

Query: 169 TG-GAFVLVLYDEIKKV 216
                F L+ Y+++++V
Sbjct: 186 IPFSGFQLLFYEKLRQV 202


>SPAC227.03c |||mitochondrial NAD+ transporter|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 371

 Score = 27.9 bits (59), Expect = 1.7
 Identities = 14/48 (29%), Positives = 21/48 (43%)
 Frame = +1

Query: 76  YKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFVLVLYDEIKKVL 219
           Y NT   +  I K EG + F++G F ++           LY+  K  L
Sbjct: 230 YNNTFDAFRKIYKYEGLAAFYRGLFPSLFGTLHVGIQFPLYEYFKSFL 277


>SPCC970.10c |brl2|rfp1|ubiquitin-protein ligase E3
           Brl2|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 680

 Score = 26.6 bits (56), Expect = 3.9
 Identities = 8/22 (36%), Positives = 11/22 (50%)
 Frame = -2

Query: 85  CSCTGYRSWHDQTASSCAYGLC 20
           CS   +  W D+  S C +G C
Sbjct: 627 CSVCNFERWKDRIISLCGHGFC 648


>SPAC688.09 |||pyrimidine nucletide transporter |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 361

 Score = 25.8 bits (54), Expect = 6.9
 Identities = 18/68 (26%), Positives = 33/68 (48%), Gaps = 2/68 (2%)
 Frame = +1

Query: 13  PFDTVRRRMMM--QSGRAKSDILYKNTIHCWATIAKTEGTSPFFKGAFSNVLRGTGGAFV 186
           P   V+ R+ +  +SG+A     Y+++I C     + EG    +KG  +++L        
Sbjct: 182 PIWLVKTRLQLDKKSGQAAQ---YRSSIDCIIKTIRLEGFRGLYKGLSASLLGVGESTLQ 238

Query: 187 LVLYDEIK 210
            VLY++ K
Sbjct: 239 WVLYEKFK 246


>SPAC17H9.08 |||mitochondrial coenzyme A
           transporter|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 326

 Score = 25.8 bits (54), Expect = 6.9
 Identities = 17/48 (35%), Positives = 23/48 (47%), Gaps = 1/48 (2%)
 Frame = +1

Query: 4   ISYPFDTVRRRMMMQSGRA-KSDILYKNTIHCWATIAKTEGTSPFFKG 144
           +SYPF+  RR+M +   R  KS +  K  +    T  K  G   FF G
Sbjct: 253 VSYPFEVCRRKMQIGGIRKNKSFLRLKQVVQ---TTYKEAGMRGFFVG 297


>SPAC23A1.17 |||WIP homolog|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1611

 Score = 25.8 bits (54), Expect = 6.9
 Identities = 10/19 (52%), Positives = 14/19 (73%)
 Frame = -1

Query: 194  KTSTKAPPVPLRTLEKAPL 138
            K S+KAPPVPL + +  P+
Sbjct: 1016 KLSSKAPPVPLPSADAPPI 1034


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,943,138
Number of Sequences: 5004
Number of extensions: 56179
Number of successful extensions: 144
Number of sequences better than 10.0: 16
Number of HSP's better than 10.0 without gapping: 136
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 143
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 371330890
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).