SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30022
         (834 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces...    27   2.5  
SPBC1773.11c |mug89||CDC50 domain protein|Schizosaccharomyces po...    26   5.7  
SPBC29A10.06c |||conserved fungal protein|Schizosaccharomyces po...    26   7.6  

>SPCC970.08 |||inositol polyphosphate kinase |Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 967

 Score = 27.5 bits (58), Expect = 2.5
 Identities = 12/29 (41%), Positives = 17/29 (58%)
 Frame = -2

Query: 830 PEVRPPKSFRPKSLRPKSTAQSPRPIAPT 744
           P+ R      PKSL  KS++   RP++PT
Sbjct: 432 PDKRSHSYGSPKSLHHKSSSAGERPVSPT 460


>SPBC1773.11c |mug89||CDC50 domain protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 396

 Score = 26.2 bits (55), Expect = 5.7
 Identities = 11/33 (33%), Positives = 19/33 (57%)
 Frame = -2

Query: 818 PPKSFRPKSLRPKSTAQSPRPIAPTRFLLGLIF 720
           P  SFR + ++      +P+ + P  F+LG+IF
Sbjct: 25  PNTSFRQQRIKSWQPLLTPKIVLPLFFVLGIIF 57


>SPBC29A10.06c |||conserved fungal protein|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 295

 Score = 25.8 bits (54), Expect = 7.6
 Identities = 11/39 (28%), Positives = 22/39 (56%)
 Frame = +2

Query: 614 TLVYVLVKKPEEQPDIIIPNSSTHFSPSKPEVYFHQISN 730
           TL+ +LV+    Q  + + ++STH   S    Y H++++
Sbjct: 254 TLLALLVESNNIQEALELSSNSTHLQKSAVNTYLHKLNS 292


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,830,838
Number of Sequences: 5004
Number of extensions: 50729
Number of successful extensions: 167
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 157
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 166
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 410448950
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).