SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30015
         (660 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC839.13c |rpl1601||60S ribosomal protein L13/L16|Schizosaccha...   153   2e-38
SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein L13/L16|Schiz...   153   2e-38
SPBC2G2.05 |rpl1603|rpl16c|60S ribosomal protein L13/L16|Schizos...   150   2e-37
SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces po...    30   0.34 
SPBP8B7.17c |||phosphomethylpyrimidine kinase|Schizosaccharomyce...    29   0.78 
SPCC790.03 |||rhomboid family protease|Schizosaccharomyces pombe...    27   2.4  
SPCC16C4.09 |sts5|orb4|RNB-like protein|Schizosaccharomyces pomb...    26   4.2  
SPBC3E7.01 |fab1|ste12, SPBC6B1.11c|1-phosphatidylinositol-3-pho...    26   5.5  
SPAC1B9.02c |sck1||serine/threonine protein kinase Sck1|Schizosa...    25   7.3  
SPAC16E8.15 |tif45|tif1|translation initiation factor eIF4E, 4F ...    25   7.3  
SPBC646.08c |||oxysterol binding protein |Schizosaccharomyces po...    25   9.7  

>SPBC839.13c |rpl1601||60S ribosomal protein
           L13/L16|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 197

 Score =  153 bits (372), Expect = 2e-38
 Identities = 78/160 (48%), Positives = 98/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           K +VID +GHLLGRLA+V+AK LL G KVVVVRCE++NISG+FFRNKLK +++LRK C  
Sbjct: 6   KVVVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRY 65

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RG FHFRAPS+I  K V      K +  +  L     + G   P             
Sbjct: 66  NPSRGAFHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQAVEGIPPPFDKQKRVVVPAAL 125

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                      C VGRLS E+GWKY D+V KLE++RK K+
Sbjct: 126 RVLRLKPGRKYCTVGRLSSEVGWKYNDIVAKLEERRKVKS 165


>SPAC23A1.11 |rpl1602|rpl16-2|60S ribosomal protein
           L13/L16|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 197

 Score =  153 bits (371), Expect = 2e-38
 Identities = 78/160 (48%), Positives = 98/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           K +VID +GHLLGRLA+V+AK LL G KVVVVRCE++NISG+FFRNKLK +++LRK C  
Sbjct: 6   KVVVIDAKGHLLGRLASVVAKQLLGGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRY 65

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RG FHFRAPS+I  K V      K +  +  L     + G   P             
Sbjct: 66  NPSRGAFHFRAPSRIFQKAVRGMLPHKTARGQAALEHLQAVEGIPPPFDKQKRVVVPAAL 125

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                      C VGRLS E+GWKY D+V KLE++RK K+
Sbjct: 126 RVLRLKPGRKYCTVGRLSSEVGWKYSDIVSKLEERRKVKS 165


>SPBC2G2.05 |rpl1603|rpl16c|60S ribosomal protein
           L13/L16|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 197

 Score =  150 bits (364), Expect = 2e-37
 Identities = 73/160 (45%), Positives = 98/160 (61%)
 Frame = +3

Query: 15  KAIVIDGRGHLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFFRNKLKLMSFLRKRCNV 194
           K ++ID +GHL+GRLA+ +AK LL G KVVVVRCE++NISG+FFRNKLK +++LRK C  
Sbjct: 6   KLVIIDAKGHLMGRLASTVAKQLLAGQKVVVVRCEELNISGHFFRNKLKYLAYLRKACRY 65

Query: 195 NPARGPFHFRAPSKILWKTVEA*SHTKQSVARMLLGGYVHMMGALLPLITXXXXXXXXXX 374
           NP+RG FHFRAPS+I  K V      K +   + L     + G   P             
Sbjct: 66  NPSRGAFHFRAPSRIFTKAVRGMLPHKTTRGNIALKNLQALEGIPPPFDKQKRLVVPAAL 125

Query: 375 XXXXXXXXXXXCHVGRLSHEIGWKYRDVVRKLEDKRKGKA 494
                      C +GRLS E+GWKY+++V KLE++RK K+
Sbjct: 126 RVLRLKPSRKYCTIGRLSSEVGWKYKNIVSKLEERRKIKS 165


>SPAPB24D3.09c |pdr1||ABC transporter Pdr1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 1396

 Score = 29.9 bits (64), Expect = 0.34
 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 1/60 (1%)
 Frame = -2

Query: 575 MVFVAFDTFSPASLVILL-SFFSWHSLNSLALPLVFKLTNNITVFPSNFMGQSAYMTVIY 399
           +VF A  T S   ++ L  S F  H + SL  P    + +++  FP   +  + Y  ++Y
Sbjct: 471 IVFTAIQTMSEVDIIFLKKSLFKEHRVQSLYHPSAALMGSSLVEFPMRIVVVTMYDIIVY 530


>SPBP8B7.17c |||phosphomethylpyrimidine kinase|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 506

 Score = 28.7 bits (61), Expect = 0.78
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +3

Query: 42  HLLGRLAAVIAKVLLEGNKVVVVRCEQINISGNFF 146
           H L  + AV  K++  G K VV+RC+ I  + +FF
Sbjct: 157 HHLEDVKAVGKKLIKAGCKNVVIRCDDIPFASDFF 191


>SPCC790.03 |||rhomboid family protease|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 248

 Score = 27.1 bits (57), Expect = 2.4
 Identities = 10/37 (27%), Positives = 23/37 (62%)
 Frame = -2

Query: 527 LLSFFSWHSLNSLALPLVFKLTNNITVFPSNFMGQSA 417
           L+SFF+  S+ +   P+++ +   I V  ++F+G ++
Sbjct: 145 LISFFNLFSIPAYCFPIIYLIMTTILVPKASFIGHAS 181


>SPCC16C4.09 |sts5|orb4|RNB-like protein|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1066

 Score = 26.2 bits (55), Expect = 4.2
 Identities = 23/83 (27%), Positives = 35/83 (42%), Gaps = 7/83 (8%)
 Frame = -1

Query: 486 PSSCLQAYEQHHGISIQFHGTVCLHD-SNLRP-----GFRQKXXXXXXXXXXXRLSKGG- 328
           PSS  Q     H  +  F GT+  H+ SN RP       R+              S GG 
Sbjct: 220 PSSLSQTNSPTHAANPSFPGTIVTHNTSNFRPEGGGHRHRRSTGSLSVGSSGSGFSSGGS 279

Query: 327 GHPSYVRSLLRAFLPRSVLCGIM 259
           G+P   ++L   +LP+S +  ++
Sbjct: 280 GNPR--KNLFSPYLPQSSIPALL 300


>SPBC3E7.01 |fab1|ste12,
           SPBC6B1.11c|1-phosphatidylinositol-3-phosphate 5-kinase
           Fab1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 1932

 Score = 25.8 bits (54), Expect = 5.5
 Identities = 10/24 (41%), Positives = 17/24 (70%)
 Frame = -1

Query: 327 GHPSYVRSLLRAFLPRSVLCGIMP 256
           G+ SY+ + L+AFLP++V   + P
Sbjct: 381 GNESYLSNFLKAFLPKTVCDYLFP 404


>SPAC1B9.02c |sck1||serine/threonine protein kinase
           Sck1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 696

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 15/55 (27%), Positives = 27/55 (49%)
 Frame = -3

Query: 226 ALKWKGPRAGFTLHLLRRNDISLSLFLKKLPEILICSQRTTTTLFPSRRTLAMTA 62
           AL+  G      ++L+R+ND +    +KK+ + LI  ++  T     R  L  T+
Sbjct: 304 ALRLIGKGTFGQVYLVRKNDTNRIYAMKKISKKLIVRKKEVTHTLGERNILVRTS 358


>SPAC16E8.15 |tif45|tif1|translation initiation factor eIF4E, 4F
           complex subunit |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 218

 Score = 25.4 bits (53), Expect = 7.3
 Identities = 13/30 (43%), Positives = 16/30 (53%)
 Frame = +1

Query: 550 KVSKATNTISLPSSKFLWIQFRDLRNYNQK 639
           K S+  NT+S P  K L   F D  N+N K
Sbjct: 8   KESQTENTVSEPQEKALRTVFDDKINFNLK 37


>SPBC646.08c |||oxysterol binding protein |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 516

 Score = 25.0 bits (52), Expect = 9.7
 Identities = 14/36 (38%), Positives = 20/36 (55%)
 Frame = -2

Query: 350 VDGYQREEGTHHMYVAS*EHSCHALFCVGSCLYSLP 243
           V+GYQ+EEG   + V S    C  +  + S  +SLP
Sbjct: 30  VEGYQKEEGKFKL-VLSILKQCIGVKDIASLRFSLP 64


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,810,591
Number of Sequences: 5004
Number of extensions: 56757
Number of successful extensions: 155
Number of sequences better than 10.0: 11
Number of HSP's better than 10.0 without gapping: 149
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 149
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 299817502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).