SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30014
         (611 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces p...   134   1e-32
SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces ...   131   7e-32
SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr 1|||M...   110   2e-25
SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyce...    96   4e-21
SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyc...    82   7e-17
SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces p...    33   0.025
SPBPB8B6.04c |grt1|SPAPB8B6.04c, SPAPB8B6.04c|transcription fact...    30   0.30 
SPCC663.03 |pmd1||leptomycin efflux transporter Pmd1|Schizosacch...    29   0.53 
SPAPB17E12.13 |rpl1802|rpl18-2|60S ribosomal protein L18|Schizos...    28   0.93 
SPBC19F5.02c |||U3 snoRNP protein Utp4 |Schizosaccharomyces pomb...    27   1.6  
SPCC895.09c |ucp12||ATP-dependent RNA helicase Ucp1 |Schizosacch...    27   1.6  
SPAC22E12.11c |set3||histone lysine methyltransferase Set3|Schiz...    27   1.6  
SPAC2C4.15c |ubx2|ucp13|UBX domain protein Ubx2|Schizosaccharomy...    27   2.1  
SPBC11C11.07 |rpl1801|rpl18-1, rpl18|60S ribosomal protein L18|S...    27   2.1  
SPAC2E1P3.04 |||copper amine oxidase |Schizosaccharomyces pombe|...    27   2.8  
SPBC1921.05 |ape2||aminopeptidase Ape2|Schizosaccharomyces pombe...    26   3.7  
SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster ...    26   3.7  
SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual        26   4.9  
SPAC20G8.10c ||SPAC3A12.01c|beclin family protein|Schizosaccharo...    26   4.9  
SPCC24B10.22 ||SPCPB16A4.01|mitochondrial DNA polymerase gamma c...    26   4.9  
SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor Sp...    25   6.5  
SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18 |Sch...    25   6.5  
SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase Wis1|Schizosaccha...    25   8.6  
SPBC18E5.01 ||SPBC29A3.19|cycloisomerase 2 family|Schizosaccharo...    25   8.6  

>SPCC1739.13 |ssa2||heat shock protein Ssa2|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 647

 Score =  134 bits (323), Expect = 1e-32
 Identities = 72/144 (50%), Positives = 92/144 (63%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           YSDNQPGVLIQVFEGERA TKD NLLGKFEL+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YSDNQPGVLIQVFEGERARTKDCNLLGKFELSGIPPAPRGVPQIEVTFDVDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +EK T K  +  +   K    ++     +      +     +   IQ +  +     S  
Sbjct: 489 LEKGTGKTQKITITNDKGRLSKEEIDRMVAEAEKYKAEDEAESGRIQAKNHLESYAYSL- 547

Query: 407 SATMEDEKLKEKILLNSDKQTIPR 478
             +++D  LK+K+   SDK+T+ +
Sbjct: 548 RNSLDDPNLKDKVDA-SDKETVDK 570


>SPAC13G7.02c |ssa1||heat shock protein Ssa1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 644

 Score =  131 bits (317), Expect = 7e-32
 Identities = 71/144 (49%), Positives = 91/144 (63%)
 Frame = +2

Query: 47  YSDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSA 226
           Y+DNQPGVLIQVFEGERA TKD NLLGKFEL+GIPPAPRGVPQIEVTFD+DANGILNVSA
Sbjct: 429 YADNQPGVLIQVFEGERARTKDCNLLGKFELSGIPPAPRGVPQIEVTFDVDANGILNVSA 488

Query: 227 IEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQECIGILLASA* 406
           +EK T K  +  +   K    ++     +      +     +   IQ +  +     S  
Sbjct: 489 LEKGTGKTQKITITNDKGRLSKEEIDRMVSEAEKYKAEDEAETSRIQAKNHLESYAYSL- 547

Query: 407 SATMEDEKLKEKILLNSDKQTIPR 478
             +++D  LK+K+   SDK+ I +
Sbjct: 548 RNSLDDPNLKDKVDA-SDKEAIDK 570


>SPAC22A12.15c |bip1|bip|BiP |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 663

 Score =  110 bits (264), Expect = 2e-25
 Identities = 49/62 (79%), Positives = 57/62 (91%)
 Frame = +2

Query: 53  DNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAIE 232
           DNQ  VLIQV+EGER +TKDNNLLGKF+L GIPPAPRGVPQIEVTF++DANG+L VSA++
Sbjct: 460 DNQNTVLIQVYEGERTLTKDNNLLGKFDLRGIPPAPRGVPQIEVTFEVDANGVLTVSAVD 519

Query: 233 KS 238
           KS
Sbjct: 520 KS 521



 Score = 46.8 bits (106), Expect = 2e-06
 Identities = 20/31 (64%), Positives = 26/31 (83%)
 Frame = +1

Query: 250 EQITITNDKGRLSKEEIERMVNEAEKYRNED 342
           E++ I NDKGRLS+E+IERMV EAE++  ED
Sbjct: 527 EKLVIKNDKGRLSEEDIERMVKEAEEFAEED 557


>SPAC664.11 |ssc1|ssp1|Hsp70 chaperone mtHsp70|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 674

 Score = 95.9 bits (228), Expect = 4e-21
 Identities = 41/68 (60%), Positives = 57/68 (83%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +D Q  V I+VF+GER + +DN L+G F+LTGI PAP+G PQIEV+FD+DA+GI+NVSA 
Sbjct: 473 ADGQTAVEIRVFQGERELVRDNKLIGNFQLTGIAPAPKGQPQIEVSFDVDADGIINVSAR 532

Query: 230 EKSTNKEN 253
           +K+TNK++
Sbjct: 533 DKATNKDS 540



 Score = 29.5 bits (63), Expect = 0.40
 Identities = 15/29 (51%), Positives = 18/29 (62%)
 Frame = +1

Query: 256 ITITNDKGRLSKEEIERMVNEAEKYRNED 342
           IT+    G L+  EIE MV +AEKYR  D
Sbjct: 542 ITVAGSSG-LTDSEIEAMVADAEKYRASD 569


>SPBC1709.05 |sks2|hsc1|heat shock protein Sks2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 613

 Score = 81.8 bits (193), Expect = 7e-17
 Identities = 35/66 (53%), Positives = 49/66 (74%)
 Frame = +2

Query: 50  SDNQPGVLIQVFEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDIDANGILNVSAI 229
           +DNQ  V   V++GER    +N  LG+F+LTGIPP PRG  ++E TF++DANGIL V+A+
Sbjct: 435 ADNQTTVTFPVYQGERVNCAENEPLGEFQLTGIPPMPRGQAELEATFELDANGILKVTAV 494

Query: 230 EKSTNK 247
           EK+T +
Sbjct: 495 EKTTGR 500


>SPBC17D1.01 ||SPBC17D11.09|sequence orphan|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 584

 Score = 33.5 bits (73), Expect = 0.025
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 1/76 (1%)
 Frame = -3

Query: 309 HTLDLFLGET-TFVVGNGDLFSLLVDFSIAETLRIPLASMSKVTSI*GTPRGAGGIPVSS 133
           H++   L ET T V GNG++     DFS+++ + + L + S   S   +P     + +SS
Sbjct: 392 HSIFSALSETPTPVSGNGNVADAPPDFSLSQVMPLDLIAPSMQPSAVSSPMSESHVQISS 451

Query: 132 NLPSKLLSLVIARSPS 85
            +P   +S +  R  S
Sbjct: 452 EMPRTGMSALPMRPRS 467


>SPBPB8B6.04c |grt1|SPAPB8B6.04c, SPAPB8B6.04c|transcription factor
           Grt1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 648

 Score = 29.9 bits (64), Expect = 0.30
 Identities = 17/66 (25%), Positives = 33/66 (50%), Gaps = 2/66 (3%)
 Frame = +1

Query: 181 GHLRHRCQRYPQRFRYREVHQQGEQITITNDKGRLSKEEIERM-VNEAEKYRN-EDDKAK 354
           G +   CQ+Y +   YR+ +++ +++   ND  ++     E+M + E    RN  DD + 
Sbjct: 27  GDVCFECQKYNENCVYRQFYRKIKRLKYNNDNSKIDNFSNEQMNIPEFISVRNLNDDSSS 86

Query: 355 GDHPGP 372
            +  GP
Sbjct: 87  IEFFGP 92


>SPCC663.03 |pmd1||leptomycin efflux transporter
           Pmd1|Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1362

 Score = 29.1 bits (62), Expect = 0.53
 Identities = 14/24 (58%), Positives = 16/24 (66%)
 Frame = +1

Query: 274 KGRLSKEEIERMVNEAEKYRNEDD 345
           KG LSKEE+ER V +A K  N  D
Sbjct: 525 KGTLSKEELERRVYDAAKLANAYD 548


>SPAPB17E12.13 |rpl1802|rpl18-2|60S ribosomal protein
           L18|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 187

 Score = 28.3 bits (60), Expect = 0.93
 Identities = 17/58 (29%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
 Frame = +3

Query: 354 RRPSRAKNALESYWLQHEVLPWRMRSSR--KRFS*TLTSRPFLEQVQHPPIQVDGISS 521
           R+  R+K A E+ +L+  V  +R  + R   RF+  +  R F  +   PPI +  I++
Sbjct: 11  RKSQRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSKTNRPPISISKIAA 68


>SPBC19F5.02c |||U3 snoRNP protein Utp4 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 710

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 19/56 (33%), Positives = 22/56 (39%)
 Frame = +3

Query: 345 QGKRRPSRAKNALESYWLQHEVLPWRMRSSRKRFS*TLTSRPFLEQVQHPPIQVDG 512
           Q  R     K  L   W  HEVL WR+ S   RF   +      E + H  I  DG
Sbjct: 339 QRPRMAVAPKARLFMLWNDHEVLLWRIGSPGYRFLLKIVLAD-EENISHAAISPDG 393


>SPCC895.09c |ucp12||ATP-dependent RNA helicase Ucp1
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 1327

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 16/65 (24%), Positives = 28/65 (43%)
 Frame = +2

Query: 416 MEDEKLKEKILLNSDKQTIPRTSATSTHSSGWDFQSRLAEQGGV*AQGRKNWEGHLTIPI 595
           +E  K KEK +    K ++         ++G    SR   +  V   G  +W G + + +
Sbjct: 15  LETSKNKEKNIKGKKKNSLDPIEKNKQETAGLQTTSRPTAKQLV---GGSSWTGKIPVVL 71

Query: 596 INEDC 610
           +NE C
Sbjct: 72  LNEHC 76


>SPAC22E12.11c |set3||histone lysine methyltransferase
           Set3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 859

 Score = 27.5 bits (58), Expect = 1.6
 Identities = 14/42 (33%), Positives = 21/42 (50%)
 Frame = +2

Query: 152 PAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPTTK 277
           PA + +P   V  D+     L  S  EK   K+ +SPLP+ +
Sbjct: 461 PAVKSLPTESVGIDVVMEPKLQPSVKEKKPTKDLQSPLPSVE 502


>SPAC2C4.15c |ubx2|ucp13|UBX domain protein Ubx2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 427

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 18/46 (39%), Positives = 23/46 (50%)
 Frame = -3

Query: 222 ETLRIPLASMSKVTSI*GTPRGAGGIPVSSNLPSKLLSLVIARSPS 85
           E L  PLA MS  TSI G   G GG P  +    + +  +  +SPS
Sbjct: 76  EVLVDPLADMSAGTSIMGNNFGFGGFPRMNRRQRRRMG-IFDQSPS 120


>SPBC11C11.07 |rpl1801|rpl18-1, rpl18|60S ribosomal protein
           L18|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 187

 Score = 27.1 bits (57), Expect = 2.1
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
 Frame = +3

Query: 354 RRPSRAKNALESYWLQHEVLPWRMRSSR--KRFS*TLTSRPFLEQVQHPPIQVDGISS 521
           ++  R+K A E+ +L+  V  +R  + R   RF+  +  R F  +   PPI +  I++
Sbjct: 11  KKSQRSKPASENVYLKLLVKLYRFLARRTDSRFNKAILKRLFQSKTNRPPISISKIAA 68


>SPAC2E1P3.04 |||copper amine oxidase |Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 712

 Score = 26.6 bits (56), Expect = 2.8
 Identities = 14/32 (43%), Positives = 17/32 (53%), Gaps = 1/32 (3%)
 Frame = +3

Query: 456 LTSRPFLEQVQHPPIQVDGISSPGWP-SKEEY 548
           L   P L+   +    VDG+S PG P SKE Y
Sbjct: 464 LRLNPMLDGYSNSVAVVDGVSGPGEPGSKENY 495


>SPBC1921.05 |ape2||aminopeptidase Ape2|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 882

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 9/21 (42%), Positives = 14/21 (66%)
 Frame = +2

Query: 461 KQTIPRTSATSTHSSGWDFQS 523
           K+ +   SAT  HS GW+F++
Sbjct: 642 KKLVLEVSATKAHSLGWEFKA 662


>SPBC16G5.16 |||transcription factor zf-fungal binuclear cluster
           type |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 827

 Score = 26.2 bits (55), Expect = 3.7
 Identities = 13/28 (46%), Positives = 14/28 (50%)
 Frame = +3

Query: 6   TLPSPLNRLRHSPPTLITNPEYSSKYLR 89
           T   P  RLRH+P   I   E   KYLR
Sbjct: 43  TYGQPFKRLRHAPEKYIEFLELRLKYLR 70


>SPCC737.08 |||midasin |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 4717

 Score = 25.8 bits (54), Expect = 4.9
 Identities = 10/43 (23%), Positives = 21/43 (48%)
 Frame = +1

Query: 241  QQGEQITITNDKGRLSKEEIERMVNEAEKYRNEDDKAKGDHPG 369
            +  EQ    N+   +SKE+  + + + ++   ED++   D  G
Sbjct: 4018 KSNEQSAANNESDLVSKEDDNKALEDKDRQEKEDEEEMSDDVG 4060


>SPAC20G8.10c ||SPAC3A12.01c|beclin family
           protein|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 464

 Score = 25.8 bits (54), Expect = 4.9
 Identities = 21/78 (26%), Positives = 37/78 (47%), Gaps = 3/78 (3%)
 Frame = -2

Query: 226 SGNVEDTVGIDVEGDLNLRHATRRRWDPGQLEFTEQVVIFGH--STLTLKYLDEYSGLVI 53
           +GN      +D+     L+    RR+D G + F + +  FG   +  T   +  Y+    
Sbjct: 361 NGNQVKPTKLDLFSSGELKIFMNRRFDQGMVAFLDYLHQFGDFCAAKTPSAVLPYAIEND 420

Query: 52  RVGGECLSL-FSGDGSVT 2
           R+GG+C+ L F+ D + T
Sbjct: 421 RIGGKCIRLAFNQDENWT 438


>SPCC24B10.22 ||SPCPB16A4.01|mitochondrial DNA polymerase gamma
           catalytic subunit|Schizosaccharomyces pombe|chr
           3|||Manual
          Length = 1018

 Score = 25.8 bits (54), Expect = 4.9
 Identities = 9/17 (52%), Positives = 9/17 (52%)
 Frame = -3

Query: 540 PCSASLDWKSHPLEWVD 490
           P    L WK HPL W D
Sbjct: 491 PILLRLKWKKHPLAWSD 507


>SPAC1F7.01c |spt6|SPAC694.07c|transcription elongation factor
            Spt6|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1365

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 16/60 (26%), Positives = 28/60 (46%)
 Frame = +2

Query: 194  IDANGILNVSAIEKSTNKENRSPLPTTKVVSPRKRSSVWLMRQRSTETRMTRQKETIQGQ 373
            +D + ++ +   E  TNK   + LP    + PRK   V L +  +T  R+  + + I  Q
Sbjct: 850  VDISSLVGIDINEAVTNKYEANILPYIAGLGPRKADYV-LKKIAATGGRIDNRSDLISKQ 908


>SPAPB18E9.02c |ppk18||serine/threonine protein kinase Ppk18
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1316

 Score = 25.4 bits (53), Expect = 6.5
 Identities = 18/62 (29%), Positives = 26/62 (41%)
 Frame = -3

Query: 237 DFSIAETLRIPLASMSKVTSI*GTPRGAGGIPVSSNLPSKLLSLVIARSPSNTWMSTPGW 58
           + S    L IP+AS  K  S   T  G G    S + P   L++ + R+      S   +
Sbjct: 479 NLSRRNNLAIPIASRRKSVSAVNTLYGVGSSYTSESFPFSKLTVPVERNSFRETESPKPF 538

Query: 57  LS 52
           LS
Sbjct: 539 LS 540


>SPBC409.07c |wis1|spc2, smf2|MAP kinase kinase
           Wis1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 605

 Score = 25.0 bits (52), Expect = 8.6
 Identities = 12/46 (26%), Positives = 22/46 (47%)
 Frame = +2

Query: 134 ELTGIPPAPRGVPQIEVTFDIDANGILNVSAIEKSTNKENRSPLPT 271
           E+   PP PR VP + +     +    +++   K  +++ R  LPT
Sbjct: 75  EIPSDPPLPRAVPTVRLGRSTSSRSRNSLNLDMKDPSEKPRRSLPT 120


>SPBC18E5.01 ||SPBC29A3.19|cycloisomerase 2
           family|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 342

 Score = 25.0 bits (52), Expect = 8.6
 Identities = 12/41 (29%), Positives = 18/41 (43%)
 Frame = -2

Query: 151 WDPGQLEFTEQVVIFGHSTLTLKYLDEYSGLVIRVGGECLS 29
           WD G+    ++  I GHS  +L  L+  S L        +S
Sbjct: 61  WDNGKFSLVDRFTIDGHSPTSLCVLENGSVLTANYNSASIS 101


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,670,337
Number of Sequences: 5004
Number of extensions: 55545
Number of successful extensions: 209
Number of sequences better than 10.0: 24
Number of HSP's better than 10.0 without gapping: 197
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 207
length of database: 2,362,478
effective HSP length: 70
effective length of database: 2,012,198
effective search space used: 267622334
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).