SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30012
         (706 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC29A3.16 |||ribosome biogenesis protein Rrs1 |Schizosaccharom...    29   0.49 
SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual    27   2.6  
SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein ...    27   3.5  

>SPBC29A3.16 |||ribosome biogenesis protein Rrs1
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 166

 Score = 29.5 bits (63), Expect = 0.49
 Identities = 15/55 (27%), Positives = 27/55 (49%)
 Frame = +3

Query: 465 PPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYPTTKRREDTPYM 629
           P PE   QR  RI G+AP ++  +++F     +S  + P   Y    +  +T ++
Sbjct: 87  PKPETKWQRFARIKGIAPKKREGRLVF---DEASGEWVPKWGYKGKNKELETQWL 138


>SPAPB1E7.04c |||chitinase |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1236

 Score = 27.1 bits (57), Expect = 2.6
 Identities = 19/58 (32%), Positives = 30/58 (51%)
 Frame = -3

Query: 419  STRISATESSITSEAQTAAAAKGESTTETESIRRVSAAKGNAASRKAT*GSRMTTIAT 246
            ST  SAT SS +S A   A+  G ST+   +     ++  + A+   T GS  +++AT
Sbjct: 965  STAASATGSSTSSIA--TASVSGSSTSSVATASATDSSTSSIAAASVT-GSSTSSVAT 1019


>SPBC119.05c |||Wiskott-Aldrich syndrome homolog binding protein
           Lsb1 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 296

 Score = 26.6 bits (56), Expect = 3.5
 Identities = 13/44 (29%), Positives = 19/44 (43%)
 Frame = +3

Query: 465 PPPEPVEQRLPRIPGVAPPQKHYKIIFIKGPNSSHSYCPHNSYP 596
           PPP P +   P     APP ++ +  +   P     Y P  +YP
Sbjct: 207 PPPPPQQNYPPAASSSAPPMQYQQTAY---PPQQAPYPPVQAYP 247


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,248,696
Number of Sequences: 5004
Number of extensions: 36984
Number of successful extensions: 127
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 119
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 127
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 327172622
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).