SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30011
         (766 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC660.15 |||mRNA cleavage factor complex subunit |Schizosaccha...    75   1e-14
SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating tra...    43   6e-05
SPBC887.05c |cwf29||RNA-binding protein Cwf29|Schizosaccharomyce...    42   7e-05
SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces...    42   1e-04
SPAC57A7.04c |pabp||mRNA export shuttling protein |Schizosacchar...    42   1e-04
SPBC4F6.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr ...    41   2e-04
SPBC18H10.03 |tif35||translation initiation factor eIF3g|Schizos...    41   2e-04
SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein Sap49|Schizo...    40   4e-04
SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyce...    40   5e-04
SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|ch...    39   7e-04
SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr 1|||M...    38   0.001
SPBP22H7.02c |||RNA-binding protein Mrd1 |Schizosaccharomyces po...    37   0.004
SPCC1827.05c |||nucleolar RNA-binding protein NIFK |Schizosaccha...    36   0.005
SPBC18H10.04c |sce3|tif48|translation initiation factor eIF4B|Sc...    36   0.005
SPBC365.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr...    36   0.006
SPBC16E9.12c |pab2||poly|Schizosaccharomyces pombe|chr 2|||Manual      35   0.011
SPBC3B9.11c |ctf1||mRNA cleavage and polyadenylation specificity...    35   0.015
SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyc...    34   0.026
SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm type|Schizos...    32   0.078
SPAC343.07 |mug28||RNA-binding protein Mug28|Schizosaccharomyces...    31   0.14 
SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr ...    31   0.14 
SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr 1|||...    31   0.18 
SPBC428.12c |||RNA-binding protein|Schizosaccharomyces pombe|chr...    30   0.31 
SPAC328.05 |||RNA-binding protein involved in export of mRNAs|Sc...    29   0.55 
SPBC29A10.02 |spo5|mrb1, mug12, SPBC365.18|meiotic RNA-binding p...    29   0.96 
SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce...    27   2.2  
SPAC57A7.13 |||RNA-binding protein|Schizosaccharomyces pombe|chr...    27   2.9  
SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces po...    27   2.9  
SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regula...    27   2.9  
SPBC4B4.07c |usp102|mud1|U1 snRNP-associated protein Usp102|Schi...    27   3.9  
SPAC1952.13 |ned1||lipin|Schizosaccharomyces pombe|chr 1|||Manual      26   5.1  
SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces p...    26   6.8  
SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces p...    26   6.8  
SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory sub...    26   6.8  
SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces p...    26   6.8  
SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr 3||...    25   9.0  
SPAC11E3.13c |||1,3-beta-glucanosyltransferase |Schizosaccharomy...    25   9.0  

>SPBC660.15 |||mRNA cleavage factor complex subunit
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 474

 Score = 74.9 bits (176), Expect = 1e-14
 Identities = 35/87 (40%), Positives = 56/87 (64%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +GE++D  VM+D  T RS+GFGF+T+     V+E   ++ H +DG+I++PKRA+PREE +
Sbjct: 186 FGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVM-SKEHHLDGKIIDPKRAIPREEQE 244

Query: 435 RPEASATVKKLFVAGLKQDIEEEDLES 515
           +        K+FV G+  D  EE+  +
Sbjct: 245 K------TAKMFVGGVPGDCTEEEFRN 265



 Score = 48.4 bits (110), Expect = 1e-06
 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 1/61 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIVEPKRAVPREEI 431
           +G ++D  +M D  T R +GFGF+TY     V EA  ++P+  I G+ VE KRA P+  +
Sbjct: 270 FGRVLDATLMMDKDTGRPRGFGFVTYENESAV-EATMSQPYITIHGKPVEVKRATPKASL 328

Query: 432 K 434
           +
Sbjct: 329 R 329



 Score = 47.2 bits (107), Expect = 3e-06
 Identities = 19/48 (39%), Positives = 31/48 (64%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNH 649
           LR+YF  FG ++  +V+ D  TG+ RGFGF+ F +   V+ V  +++H
Sbjct: 179 LRDYFEQFGEVLDCTVMRDSTTGRSRGFGFLTFKNPKCVNEVMSKEHH 226



 Score = 44.0 bits (99), Expect = 2e-05
 Identities = 16/44 (36%), Positives = 29/44 (65%)
 Frame = +2

Query: 509 REYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           R +F+ FG ++  +++ DK+TG+ RGFGFV +++   V+    Q
Sbjct: 264 RNFFNQFGRVLDATLMMDKDTGRPRGFGFVTYENESAVEATMSQ 307



 Score = 35.1 bits (77), Expect = 0.011
 Identities = 15/27 (55%), Positives = 22/27 (81%), Gaps = 1/27 (3%)
 Frame = +1

Query: 190 KLFIGGLDYRTTDSSLKEFYEH-GEKL 267
           K+FIGGL++ TTD SL++++E  GE L
Sbjct: 164 KMFIGGLNWETTDDSLRDYFEQFGEVL 190



 Score = 27.1 bits (57), Expect = 2.9
 Identities = 10/27 (37%), Positives = 16/27 (59%)
 Frame = +1

Query: 169 EEPEHTRKLFIGGLDYRTTDSSLKEFY 249
           EE E T K+F+GG+    T+   + F+
Sbjct: 241 EEQEKTAKMFVGGVPGDCTEEEFRNFF 267


>SPBC17G9.05 |rct1|cyp6|RRM-containing cyclophilin regulating
           transcription Rct1|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 432

 Score = 42.7 bits (96), Expect = 6e-05
 Identities = 17/37 (45%), Positives = 25/37 (67%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           FS FG I+S  V+ DKETG    + F+EFD+ + V++
Sbjct: 264 FSRFGKIISCQVIRDKETGDSLQYAFIEFDNKESVEK 300


>SPBC887.05c |cwf29||RNA-binding protein Cwf29|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 217

 Score = 42.3 bits (95), Expect = 7e-05
 Identities = 16/31 (51%), Positives = 24/31 (77%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           FS FG  V +++V DKETGK +GF F++++D
Sbjct: 51  FSEFGEPVDINLVRDKETGKSKGFAFLKYED 81



 Score = 32.7 bits (71), Expect = 0.059
 Identities = 17/49 (34%), Positives = 29/49 (59%), Gaps = 1/49 (2%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPH-KIDGRIV 398
           +GE VD+ +++D +T +SKGF F+ Y        A +N  + K+  R+V
Sbjct: 54  FGEPVDINLVRDKETGKSKGFAFLKYEDQRSTVLAVDNMTNVKLLDRLV 102


>SPAC3G6.04 |rnp24||RNA-binding protein Rnp24|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 369

 Score = 41.9 bits (94), Expect = 1e-04
 Identities = 18/37 (48%), Positives = 26/37 (70%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           L+E+F   G I  V ++T ++TGK +GFGFV+F D D
Sbjct: 244 LKEHFGQVGQIRRVRLMTFEDTGKCKGFGFVDFPDID 280



 Score = 30.3 bits (65), Expect = 0.31
 Identities = 11/19 (57%), Positives = 15/19 (78%)
 Frame = +1

Query: 193 LFIGGLDYRTTDSSLKEFY 249
           LF+G LD+ TTD+ LKE +
Sbjct: 230 LFVGNLDFETTDADLKEHF 248


>SPAC57A7.04c |pabp||mRNA export shuttling protein
           |Schizosaccharomyces pombe|chr 1|||Manual
          Length = 653

 Score = 41.5 bits (93), Expect = 1e-04
 Identities = 19/51 (37%), Positives = 30/51 (58%)
 Frame = +2

Query: 503 RLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           RL+  FS FG I S  ++TD E GK +GFGFV +   +  ++   + N ++
Sbjct: 379 RLKAEFSAFGTITSAKIMTD-EQGKSKGFGFVCYTTPEEANKAVTEMNQRM 428



 Score = 37.5 bits (83), Expect = 0.002
 Identities = 17/39 (43%), Positives = 23/39 (58%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           + L + FS FG I+S  V  D E G  +G+GFV FD  +
Sbjct: 182 KALHDTFSAFGKILSCKVAVD-ELGNAKGYGFVHFDSVE 219



 Score = 33.9 bits (74), Expect = 0.026
 Identities = 15/35 (42%), Positives = 23/35 (65%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           + F  FG I S+S+V D +  K RGFGFV + +++
Sbjct: 279 DLFGQFGEITSLSLVKD-QNDKPRGFGFVNYANHE 312



 Score = 31.5 bits (68), Expect = 0.14
 Identities = 22/82 (26%), Positives = 41/82 (50%), Gaps = 1/82 (1%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHK-IDGRIVEPKRAVPREE 428
           A+G I    +M D + K SKGFGF+ Y+     ++A      + + G+ +    A  R+E
Sbjct: 386 AFGTITSAKIMTDEQGK-SKGFGFVCYTTPEEANKAVTEMNQRMLAGKPLYVALA-QRKE 443

Query: 429 IKRPEASATVKKLFVAGLKQDI 494
           ++R +  A ++      L+Q +
Sbjct: 444 VRRSQLEAQIQARNQFRLQQQV 465


>SPBC4F6.14 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 674

 Score = 41.1 bits (92), Expect = 2e-04
 Identities = 25/79 (31%), Positives = 38/79 (48%), Gaps = 1/79 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKRAVPREEIK 434
           G I   VV+ +P+T  ++G+GF+T+S       A    +  K+ GRI+    A PR   K
Sbjct: 29  GPIKHAVVVTNPETGENRGYGFVTFSMLEDAQRAAKELKNKKLHGRILRLDFATPR---K 85

Query: 435 RPEASATVKKLFVAGLKQD 491
           R E      K     ++QD
Sbjct: 86  RSEVDTDQNKAVKKTIRQD 104



 Score = 37.9 bits (84), Expect = 0.002
 Identities = 18/41 (43%), Positives = 23/41 (56%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           L  +FS  G I    VVT+ ETG+ RG+GFV F   +   R
Sbjct: 21  LTNFFSDVGPIKHAVVVTNPETGENRGYGFVTFSMLEDAQR 61



 Score = 25.8 bits (54), Expect = 6.8
 Identities = 11/26 (42%), Positives = 16/26 (61%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY 332
           +G +    ++KDP T RS G GFI +
Sbjct: 300 FGPLAYAKLVKDPATDRSLGRGFIKF 325


>SPBC18H10.03 |tif35||translation initiation factor
           eIF3g|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 282

 Score = 40.7 bits (91), Expect = 2e-04
 Identities = 18/37 (48%), Positives = 23/37 (62%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           LR+ F  FG I  V +  DKETG+ +GF FV + D D
Sbjct: 218 LRDLFRRFGGIQRVYLAKDKETGRAKGFAFVSYYDRD 254



 Score = 29.1 bits (62), Expect = 0.73
 Identities = 12/26 (46%), Positives = 18/26 (69%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITY 332
           +G I  V + KD +T R+KGF F++Y
Sbjct: 225 FGGIQRVYLAKDKETGRAKGFAFVSY 250


>SPAC31G5.01 |sap49|SPAPB1A11.05|RNA-binding protein
           Sap49|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 335

 Score = 39.9 bits (89), Expect = 4e-04
 Identities = 17/51 (33%), Positives = 26/51 (50%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQ 652
           R L + FS  G +V    V   E G+ +G+GFV +D ++  D      N+Q
Sbjct: 113 RVLYDTFSALGQLVKAPQVARDENGRSKGYGFVSYDSFETADAAIEAMNNQ 163



 Score = 29.5 bits (63), Expect = 0.55
 Identities = 15/43 (34%), Positives = 23/43 (53%), Gaps = 3/43 (6%)
 Frame = +3

Query: 252 AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVD---EAQNNR 371
           A G++V    +   +  RSKG+GF++Y      D   EA NN+
Sbjct: 121 ALGQLVKAPQVARDENGRSKGYGFVSYDSFETADAAIEAMNNQ 163


>SPAC25G10.01 ||SPAC2C4.18|RNA-binding protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 297

 Score = 39.5 bits (88), Expect = 5e-04
 Identities = 18/61 (29%), Positives = 36/61 (59%), Gaps = 1/61 (1%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNN-RPHKIDGRIVEPKR 410
           +++I   +G +  V +M++P TK S+GFGF+++S       A +N    +  GR++  ++
Sbjct: 117 LQQIFSKFGTVTHVRIMREPVTKASRGFGFLSFSTVEEATSAIDNLNSQEFYGRVLNVQK 176

Query: 411 A 413
           A
Sbjct: 177 A 177



 Score = 33.1 bits (72), Expect = 0.045
 Identities = 13/33 (39%), Positives = 20/33 (60%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L++ FS FG +  V ++ +  T   RGFGF+ F
Sbjct: 117 LQQIFSKFGTVTHVRIMREPVTKASRGFGFLSF 149


>SPAC22E12.02 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 219

 Score = 39.1 bits (87), Expect = 7e-04
 Identities = 20/47 (42%), Positives = 28/47 (59%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           L + FS + ++V   VV D+E GK RGFGFV F D D   +   ++N
Sbjct: 46  LYQAFSEYPSLVKTKVVRDRE-GKTRGFGFVSFKDSDQFLKAWREKN 91


>SPAC140.02 |gar2||GAR family|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 500

 Score = 38.3 bits (85), Expect = 0.001
 Identities = 16/43 (37%), Positives = 27/43 (62%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           F   G+I S+ + TD ++G+ +GFG+V F D D   + C++ N
Sbjct: 386 FGGCGDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKK-CVEMN 427



 Score = 35.5 bits (78), Expect = 0.008
 Identities = 12/34 (35%), Positives = 23/34 (67%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFD 607
           L + F  +G IV   V+ D ++G+ +G+G+V+F+
Sbjct: 279 LGQEFEEYGTIVGARVIMDGQSGRSKGYGYVDFE 312



 Score = 35.5 bits (78), Expect = 0.008
 Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEA-QNNRPHKIDGRIVEPKRAVPREEI 431
           +G IV   V+ D ++ RSKG+G++ +        A   N   +IDGR+V    + PR   
Sbjct: 286 YGTIVGARVIMDGQSGRSKGYGYVDFETPEAAKAAVAANGTKEIDGRMVNLDLSNPRPAN 345

Query: 432 KRPEA 446
            +P A
Sbjct: 346 PQPYA 350



 Score = 34.7 bits (76), Expect = 0.015
 Identities = 17/55 (30%), Positives = 27/55 (49%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPR 422
           G+I  + +  DP++ R KGFG++T+S      +      H I GR      + PR
Sbjct: 390 GDIQSIRLPTDPQSGRLKGFGYVTFSDIDSAKKCVEMNGHFIAGRPCRLDFSTPR 444


>SPBP22H7.02c |||RNA-binding protein Mrd1 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 833

 Score = 36.7 bits (81), Expect = 0.004
 Identities = 15/45 (33%), Positives = 24/45 (53%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQ 640
           L+  F  FG +  V +  DK+T   +GF +++F D D   R  L+
Sbjct: 339 LKSLFGPFGQLEQVHMPIDKKTNNPKGFAYIDFHDADDAVRAYLE 383


>SPCC1827.05c |||nucleolar RNA-binding protein NIFK
           |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 276

 Score = 36.3 bits (80), Expect = 0.005
 Identities = 12/39 (30%), Positives = 26/39 (66%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYD 616
           +++R YFS FG ++ + +  +++TG  + + F+EF+  D
Sbjct: 119 KQMRMYFSQFGPVLRLRMSRNRKTGSSKHYAFIEFESLD 157


>SPBC18H10.04c |sce3|tif48|translation initiation factor
           eIF4B|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 388

 Score = 36.3 bits (80), Expect = 0.005
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)
 Frame = +3

Query: 255 WGE-IVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEI 431
           +GE +  + ++ DP T+RS+GFG++ +  A  +  A       + GR V    A PR   
Sbjct: 114 FGEGVTSIRLVIDPLTERSRGFGYVEFETADTLSAALALSGEDLMGRPVRITVAEPRRSF 173

Query: 432 KRPEAS 449
            R E S
Sbjct: 174 AREERS 179



 Score = 31.1 bits (67), Expect = 0.18
 Identities = 14/31 (45%), Positives = 20/31 (64%), Gaps = 1/31 (3%)
 Frame = +2

Query: 527 FGN-IVSVSVVTDKETGKKRGFGFVEFDDYD 616
           FG  + S+ +V D  T + RGFG+VEF+  D
Sbjct: 114 FGEGVTSIRLVIDPLTERSRGFGYVEFETAD 144


>SPBC365.04c |||RNA-binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 233

 Score = 35.9 bits (79), Expect = 0.006
 Identities = 14/33 (42%), Positives = 23/33 (69%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           L+ +F   G + SV + TDK +G+++G+ FVEF
Sbjct: 108 LQLHFKRAGQVPSVRIPTDKTSGRQKGYAFVEF 140


>SPBC16E9.12c |pab2||poly|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 166

 Score = 35.1 bits (77), Expect = 0.011
 Identities = 12/35 (34%), Positives = 25/35 (71%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           L+ +F++ G++  V+++ DK TG  +GF ++EF +
Sbjct: 71  LQSHFASCGSVNRVTILCDKFTGHPKGFAYIEFSE 105


>SPBC3B9.11c |ctf1||mRNA cleavage and polyadenylation specificity
           factor complex subunit Ctf1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 363

 Score = 34.7 bits (76), Expect = 0.015
 Identities = 14/37 (37%), Positives = 23/37 (62%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           +++ E F+  G + +  +V D ETG  +G+GF EF D
Sbjct: 21  QQMTEIFNQVGPVKTFKLVLDPETGSGKGYGFCEFFD 57


>SPAC16E8.06c |nop12||RNA-binding protein Nop12|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 438

 Score = 33.9 bits (74), Expect = 0.026
 Identities = 16/44 (36%), Positives = 24/44 (54%)
 Frame = +2

Query: 506 LREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCL 637
           L  YF   G+I  V +V D +T   +GF +++F D   VD+  L
Sbjct: 286 LWRYFGDCGSIDYVRIVRDPKTNLGKGFAYIQFKDTMGVDKALL 329



 Score = 32.7 bits (71), Expect = 0.059
 Identities = 19/53 (35%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
 Frame = +3

Query: 258 GEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKI-DGRIVEPKRA 413
           G I  V +++DPKT   KGF +I +     VD+A      K+ +GR +   RA
Sbjct: 294 GSIDYVRIVRDPKTNLGKGFAYIQFKDTMGVDKALLLNEKKMPEGRTLRIMRA 346


>SPBC23E6.01c ||SPBPJ758.01|RNA-binding protein, rrm
           type|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 473

 Score = 32.3 bits (70), Expect = 0.078
 Identities = 14/47 (29%), Positives = 23/47 (48%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           + S + +  S  ++TD +T   RG+GFV F D +       +   QI
Sbjct: 206 FASRYNSCKSAKIMTDPQTNVSRGYGFVRFTDENDQKSALAEMQGQI 252



 Score = 26.6 bits (56), Expect = 3.9
 Identities = 8/19 (42%), Positives = 15/19 (78%)
 Frame = +3

Query: 279 VMKDPKTKRSKGFGFITYS 335
           +M DP+T  S+G+GF+ ++
Sbjct: 218 IMTDPQTNVSRGYGFVRFT 236


>SPAC343.07 |mug28||RNA-binding protein Mug28|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 609

 Score = 31.5 bits (68), Expect = 0.14
 Identities = 14/35 (40%), Positives = 21/35 (60%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           ++L E FS FG I S ++ +   T   +G+GFV F
Sbjct: 435 QQLEELFSKFGRIKSCTLASYPSTEISKGYGFVSF 469



 Score = 28.7 bits (61), Expect = 0.96
 Identities = 18/72 (25%), Positives = 32/72 (44%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G I    +   P T+ SKG+GF+++S      +A N     ++G +   KR       K
Sbjct: 444 FGRIKSCTLASYPSTEISKGYGFVSFSHPFEAVQAINT----LNGVLFGKKRLFVNYAEK 499

Query: 435 RPEASATVKKLF 470
           R +    +  +F
Sbjct: 500 REDRKKRLSAIF 511


>SPAC644.16 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 422

 Score = 31.5 bits (68), Expect = 0.14
 Identities = 12/33 (36%), Positives = 20/33 (60%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           + F   G + S  +V D E+G+ +G+GF E+ D
Sbjct: 23  DIFKQSGPVKSFQLVIDPESGQPKGYGFCEYHD 55


>SPAC1610.03c |crp79|meu5|poly|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 710

 Score = 31.1 bits (67), Expect = 0.18
 Identities = 13/36 (36%), Positives = 22/36 (61%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           + +L + FS FG+I+S  +     +G  +G+GFV F
Sbjct: 397 KSQLEDLFSPFGSILSSMLACYPNSGISKGYGFVAF 432


>SPBC428.12c |||RNA-binding protein|Schizosaccharomyces pombe|chr
           2|||Manual
          Length = 116

 Score = 30.3 bits (65), Expect = 0.31
 Identities = 16/46 (34%), Positives = 23/46 (50%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQNHQI 655
           F  FG I+SV++   KE    R + FVEFD+ +         N+ I
Sbjct: 26  FIPFGEIISVALHR-KEKAVDRSYAFVEFDEPEDAKEAMENMNYSI 70


>SPAC328.05 |||RNA-binding protein involved in export of
           mRNAs|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 434

 Score = 29.5 bits (63), Expect = 0.55
 Identities = 11/37 (29%), Positives = 23/37 (62%)
 Frame = +2

Query: 500 RRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           R L + F+  G+++   +  +  TG+ +GFG V+F++
Sbjct: 294 RNLLDLFTDIGSVIRARIAYEP-TGRSKGFGVVQFEN 329


>SPBC29A10.02 |spo5|mrb1, mug12, SPBC365.18|meiotic RNA-binding
           protein 1|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 567

 Score = 28.7 bits (61), Expect = 0.96
 Identities = 11/32 (34%), Positives = 18/32 (56%)
 Frame = +2

Query: 515 YFSTFGNIVSVSVVTDKETGKKRGFGFVEFDD 610
           Y + FG + S   + D ET   +G+GF  F++
Sbjct: 315 YTNRFGKVSSSKAIIDMETNLCKGYGFACFEE 346


>SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 604

 Score = 27.5 bits (58), Expect = 2.2
 Identities = 14/33 (42%), Positives = 21/33 (63%)
 Frame = +3

Query: 234 IKRIL*AWGEIVDVVVMKDPKTKRSKGFGFITY 332
           +K I   +G+I  V + +D +  RSKGFG+I Y
Sbjct: 356 VKAIFEPFGDIEFVHLQRDDQN-RSKGFGYIQY 387


>SPAC57A7.13 |||RNA-binding protein|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 565

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 10/29 (34%), Positives = 19/29 (65%)
 Frame = +2

Query: 518 FSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           ++T   + +V+++ +KET K R F F +F
Sbjct: 92  YATGAKVSTVTLIREKETQKSRCFAFAKF 120


>SPBC1861.04c |||RNA-binding protein Prp24|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 1014

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 13/66 (19%), Positives = 33/66 (50%)
 Frame = +3

Query: 255 WGEIVDVVVMKDPKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIK 434
           +G++  V + K  +  + KGFG++  +     + A +    ++  R++    + PRE ++
Sbjct: 780 YGQVESVRIPK--RFNQHKGFGYVVMTTNQDAENALSAAGKQLGNRVLNVVLSKPRESLE 837

Query: 435 RPEASA 452
           +   S+
Sbjct: 838 KTRVSS 843


>SPAC6F6.17 |rif1|tap1, tap11, SPAPJ736.01|telomere length regulator
           protein Rif1|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 1400

 Score = 27.1 bits (57), Expect = 2.9
 Identities = 17/57 (29%), Positives = 27/57 (47%)
 Frame = -1

Query: 187 VCVQVLHSHRRFPKASYLIFTRLKS*DVNNQLRIGFQFNLLSLCFCSIKYSVSFLSL 17
           V  +VL SH      S  + + LKS + NN +  GF     S+    + ++V F S+
Sbjct: 736 VLARVLVSHEVSRLTSEALLSELKSRNGNNSVEEGFSEEERSILLKLLSWNVKFCSI 792


>SPBC4B4.07c |usp102|mud1|U1 snRNP-associated protein
           Usp102|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 249

 Score = 26.6 bits (56), Expect = 3.9
 Identities = 13/44 (29%), Positives = 23/44 (52%)
 Frame = +2

Query: 497 RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDR 628
           +R L   F ++G ++ V     ++T + RG  FV FD+ +   R
Sbjct: 43  KRILEHLFGSYGKVIDVQA---RKTLRMRGQAFVVFDNLENASR 83


>SPAC1952.13 |ned1||lipin|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 656

 Score = 26.2 bits (55), Expect = 5.1
 Identities = 19/67 (28%), Positives = 27/67 (40%)
 Frame = +2

Query: 467 VCSWTEARH*RRRLREYFSTFGNIVSVSVVTDKETGKKRGFGFVEFDDYDPVDRVCLQQN 646
           V S+T+    R  L E      +  + S     +T K   FG+ EF+  D  D      +
Sbjct: 570 VSSFTDVNFWRSPLLELSDEEEDDTNKSTSKSPKTPKNTKFGYQEFEGIDEEDAQDYSPS 629

Query: 647 HQIKRFN 667
             IK FN
Sbjct: 630 PLIKSFN 636


>SPBC543.09 |||mitochondrial m-AAA protease|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 773

 Score = 25.8 bits (54), Expect = 6.8
 Identities = 16/51 (31%), Positives = 25/51 (49%)
 Frame = +3

Query: 333 SQAHMVDEAQNNRPHKIDGRIVEPKRAVPREEIKRPEASATVKKLFVAGLK 485
           S  H+V  A  NRP  +D  ++ P R   +  I RP+     +++F   LK
Sbjct: 432 SSEHIVVFAGTNRPDVLDPALLRPGRFDRQITIDRPDIGGR-EQIFKVHLK 481


>SPBC146.07 |prp2|mis11|U2AF large subunit |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 517

 Score = 25.8 bits (54), Expect = 6.8
 Identities = 10/31 (32%), Positives = 17/31 (54%)
 Frame = +2

Query: 512 EYFSTFGNIVSVSVVTDKETGKKRGFGFVEF 604
           E    FG+++S  ++ +   G  +GF F EF
Sbjct: 328 ELLKPFGDLLSFQLIKNIADGSSKGFCFCEF 358


>SPCC663.01c |ekc1|SPCC777.16c|protein phosphatase regulatory
           subunit Ekc1 |Schizosaccharomyces pombe|chr 3|||Manual
          Length = 838

 Score = 25.8 bits (54), Expect = 6.8
 Identities = 12/19 (63%), Positives = 13/19 (68%)
 Frame = +1

Query: 145 PSESGDDYEEPEHTRKLFI 201
           PS  G  YEEPEHTR  +I
Sbjct: 76  PSADGG-YEEPEHTRLSYI 93


>SPBC11C11.08 |srp1||SR family protein Srp1|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 275

 Score = 25.8 bits (54), Expect = 6.8
 Identities = 17/59 (28%), Positives = 29/59 (49%), Gaps = 1/59 (1%)
 Frame = +3

Query: 291 PKTKRSKGFGFITYSQAHMVDEAQNNRPHKIDGRIVEPKRAVPREE-IKRPEASATVKK 464
           P+T+ S+ F F+ Y  +   ++A     +++ GR +E    V R E  K+P  S    K
Sbjct: 41  PRTRTSRPFAFVEYEDSRDAEDAY----YEVHGRRLERGGGVLRVEWAKQPPPSGPGSK 95


>SPCC1672.11c |||P-type ATPase |Schizosaccharomyces pombe|chr
            3|||Manual
          Length = 1315

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 14/49 (28%), Positives = 25/49 (51%)
 Frame = -3

Query: 467  QLFNGGTSFWSFNLFPWNCSFWLDNSSVNFVRPIILSFINHMGLRICNK 321
            QL     SF +F +F     + L  S  N++   + +FI+H+  R+ N+
Sbjct: 1246 QLTPTSKSFQNFLIFAGVIYYLLAASGQNYIFISMTNFISHLNNRLLNR 1294


>SPAC11E3.13c |||1,3-beta-glucanosyltransferase |Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 510

 Score = 25.4 bits (53), Expect = 9.0
 Identities = 10/20 (50%), Positives = 13/20 (65%)
 Frame = +3

Query: 609 IMIQLTEYACNKITKLKDST 668
           I + L+EY CN +TK  D T
Sbjct: 255 IPLFLSEYGCNDVTKESDGT 274


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 2,925,092
Number of Sequences: 5004
Number of extensions: 57188
Number of successful extensions: 216
Number of sequences better than 10.0: 37
Number of HSP's better than 10.0 without gapping: 180
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 214
length of database: 2,362,478
effective HSP length: 71
effective length of database: 2,007,194
effective search space used: 367316502
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).