SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30009
         (801 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPAC637.11 |suv3||ATP-dependent RNA helicase Suv3|Schizosaccharo...    27   3.1  
SPBC359.03c |||amino acid permease, unknown 8|Schizosaccharomyce...    27   4.1  
SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subuni...    26   5.4  
SPAC25H1.04 |mug105||DUF1671 family protein|Schizosaccharomyces ...    26   5.4  
SPAC22G7.03 |||sequence orphan|Schizosaccharomyces pombe|chr 1||...    26   7.2  

>SPAC637.11 |suv3||ATP-dependent RNA helicase
           Suv3|Schizosaccharomyces pombe|chr 1|||Manual
          Length = 647

 Score = 27.1 bits (57), Expect = 3.1
 Identities = 12/27 (44%), Positives = 19/27 (70%)
 Frame = -2

Query: 356 VAPTKSSSIQNIEKLTKVHDRLHLNYR 276
           +A +KSSS  +++K+ K+HD L   YR
Sbjct: 108 LALSKSSSTFDLQKIKKIHDCLLSEYR 134


>SPBC359.03c |||amino acid permease, unknown 8|Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 579

 Score = 26.6 bits (56), Expect = 4.1
 Identities = 12/29 (41%), Positives = 18/29 (62%)
 Frame = +2

Query: 260 CAVDFTYN*DVICHVLLSVFQCFVLMMTL 346
           CA+ FT+  DV C V +S+F   V+ + L
Sbjct: 177 CAITFTFWTDVNCAVWISIFLVVVIGINL 205


>SPBC25H2.13c |cdc20|pol2|DNA polymerase epsilon catalytic subunit a
            Pol2 |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 2199

 Score = 26.2 bits (55), Expect = 5.4
 Identities = 16/45 (35%), Positives = 24/45 (53%)
 Frame = +2

Query: 530  IRLRLNHFDSDIALYSSITTLKIVGFALIHPVLRNVFEYKLVFQE 664
            +R++ N+ D D    S I    I+   LIHP+ R V + +  FQE
Sbjct: 1945 VRVKNNNADED----SEIVGSGILKSKLIHPLKRKVAQVRRCFQE 1985


>SPAC25H1.04 |mug105||DUF1671 family protein|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 244

 Score = 26.2 bits (55), Expect = 5.4
 Identities = 8/14 (57%), Positives = 10/14 (71%)
 Frame = +3

Query: 756 GYLLLGEGFHGKWV 797
           GY  LG+  HGKW+
Sbjct: 92  GYAQLGDNLHGKWI 105


>SPAC22G7.03 |||sequence orphan|Schizosaccharomyces pombe|chr
           1|||Manual
          Length = 236

 Score = 25.8 bits (54), Expect = 7.2
 Identities = 13/26 (50%), Positives = 16/26 (61%)
 Frame = +1

Query: 55  KQRNT*YNILIFVHSGDIHLILMTYV 132
           K R+T     IFVHSG I  +L+T V
Sbjct: 14  KVRSTSIEYPIFVHSGSISAMLLTLV 39


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 3,291,785
Number of Sequences: 5004
Number of extensions: 66364
Number of successful extensions: 133
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 131
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 133
length of database: 2,362,478
effective HSP length: 72
effective length of database: 2,002,190
effective search space used: 388424860
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).