SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2019/10/06
 
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS30008
         (465 letters)

Database: spombe 
           5004 sequences; 2,362,478 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

SPBC354.02c |sec61||translocon alpha subunit Sec61|Schizosacchar...    38   6e-04
SPBC29A3.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces...    27   1.1  
SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces pomb...    27   1.4  
SPCC794.11c |||ENTH domain protein Ent3|Schizosaccharomyces pomb...    26   2.5  
SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces pom...    26   3.3  
SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog |Schi...    25   4.3  
SPAC17H9.19c |cdt2|sev1|WD repeat protein Cdt2|Schizosaccharomyc...    25   5.7  

>SPBC354.02c |sec61||translocon alpha subunit
           Sec61|Schizosaccharomyces pombe|chr 2|||Manual
          Length = 479

 Score = 38.3 bits (85), Expect = 6e-04
 Identities = 17/28 (60%), Positives = 21/28 (75%)
 Frame = +3

Query: 6   IPTAAAFGGLCIGALSVLADFLGAIGSG 89
           IPTAA   G  +GAL+V +D LGA+GSG
Sbjct: 417 IPTAAWLSGAVVGALAVASDLLGALGSG 444


>SPBC29A3.03c |||ubiquitin-protein ligase E3 |Schizosaccharomyces
           pombe|chr 2|||Manual
          Length = 398

 Score = 27.5 bits (58), Expect = 1.1
 Identities = 17/74 (22%), Positives = 34/74 (45%)
 Frame = -1

Query: 333 IFSIKYNDVFTSNTTRYENVHLMMSIRAETTIKTELNAAVRLPLSLRDLEEQCAHAAHLR 154
           +F    N+V +     ++++H ++S  A+  I  E    + L     +L       A L 
Sbjct: 223 LFFCSRNEVLSGTNDSHDSIHHIISNNAQLNIPQEYIDVLDLDWKSLELLFVREFCAALG 282

Query: 153 LFLDKDLEVLVNDG 112
           + L+  L+++VN G
Sbjct: 283 MSLESPLDIVVNAG 296


>SPCC285.16c |msh6||MutS protein homolog|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 1254

 Score = 27.1 bits (57), Expect = 1.4
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 2/25 (8%)
 Frame = -3

Query: 274 TPNDVDSSRNDNKNGA--ERSGPTA 206
           TP DVD+S N NKN +  ER  PT+
Sbjct: 56  TPADVDNSSNVNKNSSSPERELPTS 80


>SPCC794.11c |||ENTH domain protein Ent3|Schizosaccharomyces
           pombe|chr 3|||Manual
          Length = 476

 Score = 26.2 bits (55), Expect = 2.5
 Identities = 13/33 (39%), Positives = 17/33 (51%)
 Frame = -1

Query: 144 DKDLEVLVNDGDGEQYPSARSRWPRGSRPALTE 46
           D D+E    DGDG    +A +   RGSR   T+
Sbjct: 229 DNDVEEYNEDGDGGSSDAATANSTRGSRRTTTK 261


>SPBC19C7.03 |cyr1|git2|adenylate cyclase|Schizosaccharomyces
            pombe|chr 2|||Manual
          Length = 1692

 Score = 25.8 bits (54), Expect = 3.3
 Identities = 15/49 (30%), Positives = 27/49 (55%), Gaps = 1/49 (2%)
 Frame = -3

Query: 364  STQQILN-LKSNFFDKVQRCIHIQHYQI*KRTPNDVDSSRNDNKNGAER 221
            S++QI N L+  F    ++  ++ HY + K +  DVDS+     N +E+
Sbjct: 1064 SSEQICNALRRGFLRLNKKLGNVIHYDLRKSSEGDVDSNYVTTMNISEK 1112


>SPBC19G7.17 ||SPBC36B7.01|translocon subunit Sec61 homolog
           |Schizosaccharomyces pombe|chr 2|||Manual
          Length = 475

 Score = 25.4 bits (53), Expect = 4.3
 Identities = 9/26 (34%), Positives = 15/26 (57%)
 Frame = +1

Query: 88  GTGILLAVTIIYQYFEIFVKEQAEMG 165
           G G+L+A  ++Y  FE+ V     +G
Sbjct: 447 GVGVLIASALVYASFEMIVGANTSLG 472


>SPAC17H9.19c |cdt2|sev1|WD repeat protein Cdt2|Schizosaccharomyces
           pombe|chr 1|||Manual
          Length = 490

 Score = 25.0 bits (52), Expect = 5.7
 Identities = 11/31 (35%), Positives = 15/31 (48%)
 Frame = -2

Query: 161 ISACSLTKISKYW*MMVTASSIPVPGADGPE 69
           IS+CS     K W +    +  P+P A  PE
Sbjct: 304 ISSCSANSALKLWDLRTVHTVRPLPAATTPE 334


  Database: spombe
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 2,362,478
  Number of sequences in database:  5004
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 1,874,325
Number of Sequences: 5004
Number of extensions: 35830
Number of successful extensions: 93
Number of sequences better than 10.0: 7
Number of HSP's better than 10.0 without gapping: 91
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 93
length of database: 2,362,478
effective HSP length: 67
effective length of database: 2,027,210
effective search space used: 176367270
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

The construction of this database has been supported by
Grant-in-Aid for Publication of Scientific Research Results,
JSPS, Japan (1999-2003, 2005-2018).

The EST sequencing was supported by the Genome Analysis Program,National Bioresource Project (NBRP),
Grants-in-Aid for Scientific Research, MEXT,and the Agrigenome Program, NIAS/MAFF.
The maintenance and distribution of the DNA clones are supported by the National Bioresource Project (NBRP).